BLASTX nr result
ID: Forsythia21_contig00054169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00054169 (245 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ79142.1| hypothetical protein M438DRAFT_340059 [Aureobasid... 61 3e-07 gb|KEQ69666.1| hypothetical protein M436DRAFT_55443 [Aureobasidi... 61 3e-07 >gb|KEQ79142.1| hypothetical protein M438DRAFT_340059 [Aureobasidium pullulans EXF-150] Length = 85 Score = 61.2 bits (147), Expect = 3e-07 Identities = 32/53 (60%), Positives = 33/53 (62%) Frame = -3 Query: 243 VDPHEAGKQXXXXXXXXXXXXXXXXXXXXGNGQFAGGKVDPVEAGRKGGQTSN 85 VDPHEAGKQ GNGQFAGGKVDPVEAGRKGGQ+SN Sbjct: 33 VDPHEAGKQGGQTGGSSSGGSSESTGSSGGNGQFAGGKVDPVEAGRKGGQSSN 85 >gb|KEQ69666.1| hypothetical protein M436DRAFT_55443 [Aureobasidium namibiae CBS 147.97] Length = 85 Score = 61.2 bits (147), Expect = 3e-07 Identities = 32/53 (60%), Positives = 33/53 (62%) Frame = -3 Query: 243 VDPHEAGKQXXXXXXXXXXXXXXXXXXXXGNGQFAGGKVDPVEAGRKGGQTSN 85 VDPHEAGKQ GNGQFAGGKVDPVEAGRKGGQ+SN Sbjct: 33 VDPHEAGKQGGQSSGGSTESTGSSGGSSGGNGQFAGGKVDPVEAGRKGGQSSN 85