BLASTX nr result
ID: Forsythia21_contig00054023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00054023 (244 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012850857.1| PREDICTED: clathrin light chain 1-like [Eryt... 58 3e-06 gb|EYU26157.1| hypothetical protein MIMGU_mgv1a019323mg, partial... 58 3e-06 >ref|XP_012850857.1| PREDICTED: clathrin light chain 1-like [Erythranthe guttatus] Length = 368 Score = 57.8 bits (138), Expect = 3e-06 Identities = 35/69 (50%), Positives = 41/69 (59%), Gaps = 5/69 (7%) Frame = -1 Query: 199 DEFSGDPM---MSDXXXXNMQSSEGYGFGGSPNPVYSPSTFDASNGIGGD--GKPYDTAT 35 D F G P+ +++ +MQS +GYGF GSP YSPS F G GGD KPYD A Sbjct: 42 DGFYGSPINDNINNNNNNSMQSPKGYGFVGSPQ-AYSPSPFVGGGG-GGDEYAKPYDAAA 99 Query: 34 DTEGIFTDP 8 D EGIFT P Sbjct: 100 DNEGIFTSP 108 >gb|EYU26157.1| hypothetical protein MIMGU_mgv1a019323mg, partial [Erythranthe guttata] Length = 339 Score = 57.8 bits (138), Expect = 3e-06 Identities = 35/69 (50%), Positives = 41/69 (59%), Gaps = 5/69 (7%) Frame = -1 Query: 199 DEFSGDPM---MSDXXXXNMQSSEGYGFGGSPNPVYSPSTFDASNGIGGD--GKPYDTAT 35 D F G P+ +++ +MQS +GYGF GSP YSPS F G GGD KPYD A Sbjct: 42 DGFYGSPINDNINNNNNNSMQSPKGYGFVGSPQ-AYSPSPFVGGGG-GGDEYAKPYDAAA 99 Query: 34 DTEGIFTDP 8 D EGIFT P Sbjct: 100 DNEGIFTSP 108