BLASTX nr result
ID: Forsythia21_contig00053744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00053744 (298 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003298933.1| hypothetical protein PTT_09805 [Pyrenophora ... 87 4e-15 ref|XP_001933054.1| cytochrome c1, mitochondrial precursor [Pyre... 84 4e-14 ref|XP_007702166.1| hypothetical protein COCSADRAFT_38995 [Bipol... 83 8e-14 ref|XP_007690061.1| hypothetical protein COCMIDRAFT_100825 [Bipo... 82 1e-13 ref|XP_008031620.1| hypothetical protein SETTUDRAFT_166449 [Seto... 82 1e-13 ref|XP_007714096.1| hypothetical protein COCCADRAFT_27705 [Bipol... 81 3e-13 ref|XP_003833503.1| hypothetical protein LEMA_P062640.1 [Leptosp... 81 3e-13 ref|XP_001793908.1| hypothetical protein SNOG_03340 [Phaeosphaer... 79 1e-12 gb|EMD91207.1| hypothetical protein COCHEDRAFT_1194881 [Bipolari... 78 2e-12 >ref|XP_003298933.1| hypothetical protein PTT_09805 [Pyrenophora teres f. teres 0-1] gi|311327613|gb|EFQ92970.1| hypothetical protein PTT_09805 [Pyrenophora teres f. teres 0-1] Length = 491 Score = 87.0 bits (214), Expect = 4e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 297 WVKRYKWAPLKTRKIVYQPPQNKSILDQLPKPNNSGKTNQ 178 WVKRYKWAPLKTRKIVYQPPQNKSILD +PKPNNSGKTNQ Sbjct: 452 WVKRYKWAPLKTRKIVYQPPQNKSILDHVPKPNNSGKTNQ 491 >ref|XP_001933054.1| cytochrome c1, mitochondrial precursor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978618|gb|EDU45244.1| cytochrome c1, mitochondrial precursor [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 336 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -2 Query: 297 WVKRYKWAPLKTRKIVYQPPQNKSILDQLPKPNNSGKTNQ 178 WVKRYKWAPLKTRKI+YQPPQNKSIL +PKPNNSGKTNQ Sbjct: 297 WVKRYKWAPLKTRKIIYQPPQNKSILGHVPKPNNSGKTNQ 336 >ref|XP_007702166.1| hypothetical protein COCSADRAFT_38995 [Bipolaris sorokiniana ND90Pr] gi|451848916|gb|EMD62221.1| hypothetical protein COCSADRAFT_38995 [Bipolaris sorokiniana ND90Pr] Length = 336 Score = 82.8 bits (203), Expect = 8e-14 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -2 Query: 297 WVKRYKWAPLKTRKIVYQPPQNKSILDQLPKPNNSGKTNQ 178 WVKRYKW PLK RKI+YQPPQNKSILD +PKPNNSGKTNQ Sbjct: 297 WVKRYKWGPLKNRKILYQPPQNKSILDHIPKPNNSGKTNQ 336 >ref|XP_007690061.1| hypothetical protein COCMIDRAFT_100825 [Bipolaris oryzae ATCC 44560] gi|576929850|gb|EUC43447.1| hypothetical protein COCMIDRAFT_100825 [Bipolaris oryzae ATCC 44560] Length = 336 Score = 82.4 bits (202), Expect = 1e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -2 Query: 297 WVKRYKWAPLKTRKIVYQPPQNKSILDQLPKPNNSGKTNQ 178 WVKRYKW PLK RKI+YQPPQNKSILDQ+PKPN SGKTNQ Sbjct: 297 WVKRYKWGPLKNRKILYQPPQNKSILDQIPKPNTSGKTNQ 336 >ref|XP_008031620.1| hypothetical protein SETTUDRAFT_166449 [Setosphaeria turcica Et28A] gi|482803955|gb|EOA81080.1| hypothetical protein SETTUDRAFT_166449 [Setosphaeria turcica Et28A] Length = 336 Score = 82.0 bits (201), Expect = 1e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -2 Query: 297 WVKRYKWAPLKTRKIVYQPPQNKSILDQLPKPNNSGKTNQ 178 WVKRYKWAPLK+RKI+YQPP NKSILDQ+PKPN SGKTNQ Sbjct: 297 WVKRYKWAPLKSRKILYQPPANKSILDQIPKPNTSGKTNQ 336 >ref|XP_007714096.1| hypothetical protein COCCADRAFT_27705 [Bipolaris zeicola 26-R-13] gi|576917366|gb|EUC31591.1| hypothetical protein COCCADRAFT_27705 [Bipolaris zeicola 26-R-13] gi|578489730|gb|EUN27152.1| hypothetical protein COCVIDRAFT_26513 [Bipolaris victoriae FI3] Length = 336 Score = 80.9 bits (198), Expect = 3e-13 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 297 WVKRYKWAPLKTRKIVYQPPQNKSILDQLPKPNNSGKTNQ 178 WVKRYKW PLK RKI+YQPP NKSILD +PKPNNSGKTNQ Sbjct: 297 WVKRYKWGPLKNRKILYQPPSNKSILDHIPKPNNSGKTNQ 336 >ref|XP_003833503.1| hypothetical protein LEMA_P062640.1 [Leptosphaeria maculans JN3] gi|312210051|emb|CBX90138.1| hypothetical protein LEMA_P062640.1 [Leptosphaeria maculans JN3] Length = 388 Score = 80.9 bits (198), Expect = 3e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 297 WVKRYKWAPLKTRKIVYQPPQNKSILDQLPKPNNSGKTNQ 178 WVKRYKWAPLKTRK++Y PPQ KSILDQLPKP+N+GKTNQ Sbjct: 349 WVKRYKWAPLKTRKLMYNPPQQKSILDQLPKPHNNGKTNQ 388 >ref|XP_001793908.1| hypothetical protein SNOG_03340 [Phaeosphaeria nodorum SN15] gi|111067425|gb|EAT88545.1| hypothetical protein SNOG_03340 [Phaeosphaeria nodorum SN15] Length = 334 Score = 79.0 bits (193), Expect = 1e-12 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 297 WVKRYKWAPLKTRKIVYQPPQNKSILDQLPKPNNSGKTNQ 178 WVKRYKWAPLK+RKI Y PPQ KSILDQ+PKPN SGKTNQ Sbjct: 295 WVKRYKWAPLKSRKIAYVPPQQKSILDQIPKPNTSGKTNQ 334 >gb|EMD91207.1| hypothetical protein COCHEDRAFT_1194881 [Bipolaris maydis C5] gi|477588634|gb|ENI05712.1| hypothetical protein COCC4DRAFT_31690 [Bipolaris maydis ATCC 48331] Length = 336 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 297 WVKRYKWAPLKTRKIVYQPPQNKSILDQLPKPNNSGKTNQ 178 WVKRYKW PLK RKI+YQPP KSILD +PKPNNSGKTNQ Sbjct: 297 WVKRYKWGPLKNRKILYQPPPTKSILDHIPKPNNSGKTNQ 336