BLASTX nr result
ID: Forsythia21_contig00053569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00053569 (211 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008373071.1| PREDICTED: pentatricopeptide repeat-containi... 108 2e-21 ref|XP_010647944.1| PREDICTED: pentatricopeptide repeat-containi... 107 3e-21 ref|XP_009339503.1| PREDICTED: pentatricopeptide repeat-containi... 107 4e-21 ref|XP_009336216.1| PREDICTED: putative pentatricopeptide repeat... 107 4e-21 ref|XP_007199641.1| hypothetical protein PRUPE_ppa021613mg [Prun... 107 4e-21 ref|XP_008236408.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 ref|XP_012575253.1| PREDICTED: putative pentatricopeptide repeat... 103 3e-20 ref|XP_007042573.1| Pentatricopeptide repeat-containing protein ... 101 2e-19 ref|XP_004309732.2| PREDICTED: pentatricopeptide repeat-containi... 100 4e-19 ref|XP_011088184.1| PREDICTED: pentatricopeptide repeat-containi... 100 6e-19 ref|XP_010250034.1| PREDICTED: pentatricopeptide repeat-containi... 100 6e-19 ref|XP_010068395.1| PREDICTED: putative pentatricopeptide repeat... 99 8e-19 ref|XP_002518643.1| pentatricopeptide repeat-containing protein,... 99 8e-19 ref|XP_012836882.1| PREDICTED: pentatricopeptide repeat-containi... 98 2e-18 gb|EYU37608.1| hypothetical protein MIMGU_mgv1a006142mg [Erythra... 98 2e-18 ref|XP_007143083.1| hypothetical protein PHAVU_007G042100g [Phas... 98 2e-18 ref|XP_012093072.1| PREDICTED: pentatricopeptide repeat-containi... 97 3e-18 gb|KHN06782.1| Pentatricopeptide repeat-containing protein [Glyc... 97 4e-18 ref|XP_003535694.1| PREDICTED: pentatricopeptide repeat-containi... 97 4e-18 ref|XP_011658883.1| PREDICTED: putative pentatricopeptide repeat... 94 5e-17 >ref|XP_008373071.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Malus domestica] Length = 630 Score = 108 bits (269), Expect = 2e-21 Identities = 52/70 (74%), Positives = 60/70 (85%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 +RAK VFDQM+ KD+VS NAMIMGLAVN EGEEAL LF KI+EFG+ P++GTFL LCAC Sbjct: 401 ZRAKEVFDQMLTKDIVSFNAMIMGLAVNSEGEEALRLFPKIQEFGLQPNAGTFLGALCAC 460 Query: 30 SHSGLLDKGR 1 SHSGL +KGR Sbjct: 461 SHSGLSEKGR 470 >ref|XP_010647944.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vitis vinifera] gi|731383945|ref|XP_010647945.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vitis vinifera] gi|731383947|ref|XP_010647946.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vitis vinifera] gi|731383949|ref|XP_010647947.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vitis vinifera] Length = 630 Score = 107 bits (267), Expect = 3e-21 Identities = 51/69 (73%), Positives = 59/69 (85%) Frame = -2 Query: 207 RAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCACS 28 +AK VF+QM+ KDVVS NAMIMGLA+NGEGEEAL LF K++E + P+SGTFL VLCACS Sbjct: 402 KAKDVFEQMVSKDVVSFNAMIMGLAINGEGEEALRLFSKMQELSLRPNSGTFLGVLCACS 461 Query: 27 HSGLLDKGR 1 HSGLLD GR Sbjct: 462 HSGLLDTGR 470 >ref|XP_009339503.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Pyrus x bretschneideri] gi|694423416|ref|XP_009339510.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Pyrus x bretschneideri] Length = 634 Score = 107 bits (266), Expect = 4e-21 Identities = 52/70 (74%), Positives = 59/70 (84%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 +RAK VFDQM KD+VS NAMIMGLAVN EGEEAL LF KI+EFG+ P++GTFL LCAC Sbjct: 405 ERAKEVFDQMHTKDIVSFNAMIMGLAVNSEGEEALRLFSKIQEFGLQPNAGTFLGALCAC 464 Query: 30 SHSGLLDKGR 1 SHSGL +KGR Sbjct: 465 SHSGLSEKGR 474 >ref|XP_009336216.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Pyrus x bretschneideri] Length = 238 Score = 107 bits (266), Expect = 4e-21 Identities = 52/70 (74%), Positives = 59/70 (84%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 +RAK VFDQM KD+VS NAMIMGLAVN EGEEAL LF KI+EFG+ P++GTFL LCAC Sbjct: 9 ERAKEVFDQMHTKDIVSFNAMIMGLAVNSEGEEALRLFSKIQEFGLQPNAGTFLGALCAC 68 Query: 30 SHSGLLDKGR 1 SHSGL +KGR Sbjct: 69 SHSGLSEKGR 78 >ref|XP_007199641.1| hypothetical protein PRUPE_ppa021613mg [Prunus persica] gi|462395041|gb|EMJ00840.1| hypothetical protein PRUPE_ppa021613mg [Prunus persica] Length = 643 Score = 107 bits (266), Expect = 4e-21 Identities = 50/70 (71%), Positives = 60/70 (85%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 +RAK VFDQM+ KD+VS NAMIMGLAVN EGEEAL LF +I+EFG+ P++GTFL LCAC Sbjct: 414 ERAKEVFDQMVSKDIVSFNAMIMGLAVNSEGEEALRLFSRIQEFGLQPNAGTFLGALCAC 473 Query: 30 SHSGLLDKGR 1 SHSGL ++GR Sbjct: 474 SHSGLSEEGR 483 >ref|XP_008236408.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Prunus mume] Length = 630 Score = 105 bits (262), Expect = 1e-20 Identities = 49/70 (70%), Positives = 60/70 (85%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 +RAK VFDQM+ KD+VS NAMIMGLAVN EGEEAL LF +I++FG+ P++GTFL LCAC Sbjct: 401 ERAKEVFDQMVSKDIVSFNAMIMGLAVNSEGEEALRLFSRIQKFGLQPNAGTFLGALCAC 460 Query: 30 SHSGLLDKGR 1 SHSGL ++GR Sbjct: 461 SHSGLSEEGR 470 >ref|XP_012575253.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820 [Cicer arietinum] Length = 639 Score = 103 bits (258), Expect = 3e-20 Identities = 50/70 (71%), Positives = 58/70 (82%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 DRAK VF+ I KDVV NAMIMGLAVNGEGE+AL LFYK+ E+G+ P++GTFL L AC Sbjct: 405 DRAKEVFEHAISKDVVLFNAMIMGLAVNGEGEDALRLFYKMTEYGLQPNAGTFLGALSAC 464 Query: 30 SHSGLLDKGR 1 SHSGLL+KGR Sbjct: 465 SHSGLLEKGR 474 >ref|XP_007042573.1| Pentatricopeptide repeat-containing protein [Theobroma cacao] gi|508706508|gb|EOX98404.1| Pentatricopeptide repeat-containing protein [Theobroma cacao] Length = 647 Score = 101 bits (252), Expect = 2e-19 Identities = 48/70 (68%), Positives = 59/70 (84%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 + AK VFDQMI KDVVS NAMIMGLA+NGEGEEA+ L K++E G+ P++GTFL +LCAC Sbjct: 418 EMAKRVFDQMISKDVVSFNAMIMGLAMNGEGEEAVSLLSKVQELGLHPNAGTFLGLLCAC 477 Query: 30 SHSGLLDKGR 1 SHSGL ++GR Sbjct: 478 SHSGLSEEGR 487 >ref|XP_004309732.2| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] gi|764642804|ref|XP_011471026.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] gi|764642811|ref|XP_011471027.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 611 Score = 100 bits (249), Expect = 4e-19 Identities = 47/68 (69%), Positives = 55/68 (80%) Frame = -2 Query: 204 AKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCACSH 25 AK VFDQM+ KD+VS NAMIM LAVN EGEEAL LF K+++FG+ P++GTFL LCACSH Sbjct: 382 AKEVFDQMVSKDIVSFNAMIMSLAVNSEGEEALRLFSKVQDFGLQPNAGTFLGALCACSH 441 Query: 24 SGLLDKGR 1 SG KGR Sbjct: 442 SGFSKKGR 449 >ref|XP_011088184.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Sesamum indicum] Length = 641 Score = 99.8 bits (247), Expect = 6e-19 Identities = 49/70 (70%), Positives = 56/70 (80%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 D A+ VFDQ+ EKDVVS NAMI+GLAVNG+GEEAL LF K+ E + P +GT L LCAC Sbjct: 412 DEARKVFDQISEKDVVSFNAMIIGLAVNGKGEEALTLFSKMLELRLWPDAGTLLGALCAC 471 Query: 30 SHSGLLDKGR 1 SHSGLLDKGR Sbjct: 472 SHSGLLDKGR 481 >ref|XP_010250034.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Nelumbo nucifera] Length = 632 Score = 99.8 bits (247), Expect = 6e-19 Identities = 47/69 (68%), Positives = 58/69 (84%) Frame = -2 Query: 207 RAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCACS 28 +AK VFDQM+ KDVV+ NA+IMGLA+NG+GEEAL LF ++E GV P+ GTFLSVLCAC+ Sbjct: 404 KAKEVFDQMVAKDVVAFNAIIMGLAINGKGEEALRLFSMMEELGVHPNGGTFLSVLCACN 463 Query: 27 HSGLLDKGR 1 HSGL +GR Sbjct: 464 HSGLAGEGR 472 >ref|XP_010068395.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820 [Eucalyptus grandis] gi|629097905|gb|KCW63670.1| hypothetical protein EUGRSUZ_G01317 [Eucalyptus grandis] Length = 634 Score = 99.4 bits (246), Expect = 8e-19 Identities = 48/68 (70%), Positives = 57/68 (83%) Frame = -2 Query: 204 AKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCACSH 25 AK VFDQMI KD+VS NAMIMGLA+NGEGEEAL LF I++ G+ P S TFL+ LCACSH Sbjct: 409 AKEVFDQMICKDIVSFNAMIMGLAMNGEGEEALRLFSSIQDLGLHPDSSTFLAALCACSH 468 Query: 24 SGLLDKGR 1 SGLL++G+ Sbjct: 469 SGLLEEGQ 476 >ref|XP_002518643.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542024|gb|EEF43568.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 318 Score = 99.4 bits (246), Expect = 8e-19 Identities = 47/70 (67%), Positives = 58/70 (82%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 D+AK VF QM+ KDVVS NAMIMGLA+NGEG+EA+ LF K++E G+ P+ GTFL +L AC Sbjct: 208 DKAKEVFYQMVSKDVVSFNAMIMGLAINGEGQEAVKLFSKVQELGLHPNGGTFLGLLWAC 267 Query: 30 SHSGLLDKGR 1 SHSGL D+GR Sbjct: 268 SHSGLSDEGR 277 >ref|XP_012836882.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Erythranthe guttatus] Length = 633 Score = 97.8 bits (242), Expect = 2e-18 Identities = 48/70 (68%), Positives = 58/70 (82%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 D A+ VF Q++EKDVVS NAMI+GLAVNG+G+EAL LF +++E +LP SGTFL L AC Sbjct: 403 DVAREVFAQIVEKDVVSFNAMIIGLAVNGKGDEALTLFSEMQELRLLPDSGTFLGALSAC 462 Query: 30 SHSGLLDKGR 1 SHSGLLDKGR Sbjct: 463 SHSGLLDKGR 472 >gb|EYU37608.1| hypothetical protein MIMGU_mgv1a006142mg [Erythranthe guttata] Length = 455 Score = 97.8 bits (242), Expect = 2e-18 Identities = 48/70 (68%), Positives = 58/70 (82%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 D A+ VF Q++EKDVVS NAMI+GLAVNG+G+EAL LF +++E +LP SGTFL L AC Sbjct: 225 DVAREVFAQIVEKDVVSFNAMIIGLAVNGKGDEALTLFSEMQELRLLPDSGTFLGALSAC 284 Query: 30 SHSGLLDKGR 1 SHSGLLDKGR Sbjct: 285 SHSGLLDKGR 294 >ref|XP_007143083.1| hypothetical protein PHAVU_007G042100g [Phaseolus vulgaris] gi|561016273|gb|ESW15077.1| hypothetical protein PHAVU_007G042100g [Phaseolus vulgaris] Length = 632 Score = 97.8 bits (242), Expect = 2e-18 Identities = 46/70 (65%), Positives = 57/70 (81%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 D+AK VF+ + KDVV NAMIMGLAV+GEGE+AL LFY++ EFG+ P++GTFL L AC Sbjct: 398 DKAKEVFEHTVSKDVVLFNAMIMGLAVSGEGEDALRLFYRMPEFGLQPNAGTFLGALSAC 457 Query: 30 SHSGLLDKGR 1 SHSGLL +GR Sbjct: 458 SHSGLLARGR 467 >ref|XP_012093072.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Jatropha curcas] gi|802550609|ref|XP_012093073.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Jatropha curcas] gi|643738528|gb|KDP44449.1| hypothetical protein JCGZ_16282 [Jatropha curcas] Length = 599 Score = 97.4 bits (241), Expect = 3e-18 Identities = 46/70 (65%), Positives = 59/70 (84%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 D+AK VF+QM+ KDVVS NAMIMGLA+NGEG +A+ LF K++EFG+ P+ GTFL +L AC Sbjct: 370 DKAKDVFNQMVSKDVVSFNAMIMGLAINGEGVKAVNLFSKMQEFGLHPNPGTFLGLLWAC 429 Query: 30 SHSGLLDKGR 1 SHSGL D+G+ Sbjct: 430 SHSGLSDEGQ 439 >gb|KHN06782.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 634 Score = 97.1 bits (240), Expect = 4e-18 Identities = 47/70 (67%), Positives = 56/70 (80%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 D+AK VF+ + KDVV NAMIMGLAV G+GE+AL LFYKI EFG+ P++GTFL L AC Sbjct: 400 DKAKKVFEHTVSKDVVLFNAMIMGLAVYGKGEDALRLFYKIPEFGLQPNAGTFLGALSAC 459 Query: 30 SHSGLLDKGR 1 SHSGLL +GR Sbjct: 460 SHSGLLVRGR 469 >ref|XP_003535694.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Glycine max] Length = 634 Score = 97.1 bits (240), Expect = 4e-18 Identities = 47/70 (67%), Positives = 56/70 (80%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 D+AK VF+ + KDVV NAMIMGLAV G+GE+AL LFYKI EFG+ P++GTFL L AC Sbjct: 400 DKAKKVFEHTVSKDVVLFNAMIMGLAVYGKGEDALRLFYKIPEFGLQPNAGTFLGALSAC 459 Query: 30 SHSGLLDKGR 1 SHSGLL +GR Sbjct: 460 SHSGLLVRGR 469 >ref|XP_011658883.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820 [Cucumis sativus] Length = 468 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/70 (60%), Positives = 58/70 (82%) Frame = -2 Query: 210 DRAKGVFDQMIEKDVVSLNAMIMGLAVNGEGEEALMLFYKIKEFGVLPSSGTFLSVLCAC 31 +RAK VF Q+I KDV++ NAMIMGLAVN +G+EAL LF +++E ++PS+GTF+ +L AC Sbjct: 239 ERAKEVFHQLINKDVITFNAMIMGLAVNSKGDEALKLFAQMQEINIIPSTGTFIGLLSAC 298 Query: 30 SHSGLLDKGR 1 SHSG L++GR Sbjct: 299 SHSGFLEQGR 308