BLASTX nr result
ID: Forsythia21_contig00053228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00053228 (274 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008999560.1| cytochrome c oxidase subunit 1 (mitochondrio... 160 3e-38 ref|YP_004222258.1| hypothetical protein BevumaM_p019 [Beta vulg... 158 1e-36 dbj|BAO50887.1| cytochrome c oxidase subunit 1 (mitochondrion) [... 156 6e-36 ref|YP_762344.1| cytochrome c oxidase subunit 1 [Sorghum bicolor... 156 6e-36 gb|KJB82788.1| hypothetical protein B456_013G213100 [Gossypium r... 156 6e-36 ref|YP_003587228.1| cytochrome c oxidase subunit 1 [Citrullus la... 156 6e-36 ref|YP_003433868.1| cytochrome c oxidase subunit 1 (mitochondrio... 156 6e-36 gb|ABY55197.1| cox1 (mitochondrion) [Bambusa oldhamii] gi|340748... 156 6e-36 gb|AAZ99388.1| cytochrome c oxidase subunit 1 (mitochondrion) [O... 156 6e-36 gb|AAA70319.1|AAA70319 cytochrome c oxidase subunit I [Sorghum b... 156 6e-36 gb|AAX99137.1| cytochrome c oxidase subunit I [Zea mays] 156 6e-36 gb|AAV68252.1| cytochrome oxidase subunit 1-2 [Daucus carota] 156 6e-36 gb|AAV54057.1| cytochrome oxidase subunit I [Daucus carota] 156 6e-36 ref|YP_008802500.1| cytochrome c oxidase subunit 1 (mitochondrio... 156 6e-36 gb|EPS74621.1| cytochrome c oxidase subunit 1 [Genlisea aurea] 156 6e-36 gb|AGI48771.1| cytochrome c oxidase subunit 1 (mitochondrion) [L... 156 6e-36 dbj|BAD38494.1| cytochrome c oxidase subunit1 [Oryza sativa Japo... 156 6e-36 ref|YP_588386.1| cytochrome c oxidase subunit 1 [Zea mays subsp.... 156 6e-36 ref|YP_514675.1| cytochrome c oxidase subunit 1 (mitochondrion) ... 156 6e-36 ref|NP_064063.1| cox1 gene product (mitochondrion) [Beta vulgari... 156 6e-36 >ref|YP_008999560.1| cytochrome c oxidase subunit 1 (mitochondrion) (mitochondrion) [Helianthus annuus] gi|571031388|gb|AHF21033.1| cytochrome c oxidase subunit 1 (mitochondrion) [Helianthus annuus] Length = 564 Score = 160 bits (404), Expect(2) = 3e-38 Identities = 77/79 (97%), Positives = 78/79 (98%) Frame = -3 Query: 239 HLNFMTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL 60 +LNFMTN VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL Sbjct: 34 NLNFMTNPVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQL 93 Query: 59 YNVLITAHAFLMIFFMVMP 3 YNVLITAHAFLMIFFMVMP Sbjct: 94 YNVLITAHAFLMIFFMVMP 112 Score = 25.4 bits (54), Expect(2) = 3e-38 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 273 IFRARSGATRKSSQF 229 IFRARSG TRK+ F Sbjct: 23 IFRARSGTTRKNLNF 37 >ref|YP_004222258.1| hypothetical protein BevumaM_p019 [Beta vulgaris subsp. maritima] gi|346683136|ref|YP_004842065.1| hypothetical protein BemaM_p017 [Beta macrocarpa] gi|317905696|emb|CBX33236.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439776|emb|CBX33288.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500054|emb|CBX24870.1| hypothetical protein [Beta macrocarpa] gi|384939214|emb|CBL52060.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 575 Score = 158 bits (400), Expect = 1e-36 Identities = 76/76 (100%), Positives = 76/76 (100%) Frame = -3 Query: 230 FMTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNV 51 FMTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNV Sbjct: 51 FMTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNV 110 Query: 50 LITAHAFLMIFFMVMP 3 LITAHAFLMIFFMVMP Sbjct: 111 LITAHAFLMIFFMVMP 126 >dbj|BAO50887.1| cytochrome c oxidase subunit 1 (mitochondrion) [Hevea brasiliensis] Length = 527 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >ref|YP_762344.1| cytochrome c oxidase subunit 1 [Sorghum bicolor] gi|1169032|sp|P05502.2|COX1_SORBI RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I (mitochondrion) [Sorghum bicolor] gi|868015|gb|AAA68624.1| cytochrome c oxidase subunit I [Sorghum bicolor] gi|114309657|gb|ABI60874.1| cytochrome c oxidase subunit 1 (mitochondrion) [Sorghum bicolor] Length = 530 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >gb|KJB82788.1| hypothetical protein B456_013G213100 [Gossypium raimondii] Length = 493 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >ref|YP_003587228.1| cytochrome c oxidase subunit 1 [Citrullus lanatus] gi|259156773|gb|ACV96635.1| cytochrome c oxidase subunit 1 [Citrullus lanatus] Length = 527 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >ref|YP_003433868.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza rufipogon] gi|285026139|dbj|BAI67972.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza rufipogon] Length = 400 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >gb|ABY55197.1| cox1 (mitochondrion) [Bambusa oldhamii] gi|340748029|gb|AEK66746.1| cytochrome c oxidase subunit 1 (mitochondrion) [Ferrocalamus rimosivaginus] gi|372861962|gb|AEX98107.1| cytochrome c oxidase subunit 1 (mitochondrion) [Ferrocalamus rimosivaginus] Length = 524 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >gb|AAZ99388.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza sativa Japonica Group] Length = 524 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >gb|AAA70319.1|AAA70319 cytochrome c oxidase subunit I [Sorghum bicolor] Length = 632 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >gb|AAX99137.1| cytochrome c oxidase subunit I [Zea mays] Length = 495 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >gb|AAV68252.1| cytochrome oxidase subunit 1-2 [Daucus carota] Length = 814 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >gb|AAV54057.1| cytochrome oxidase subunit I [Daucus carota] Length = 754 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >ref|YP_008802500.1| cytochrome c oxidase subunit 1 (mitochondrion) (mitochondrion) [Asclepias syriaca] gi|556562339|gb|AGZ63035.1| cytochrome c oxidase subunit 1 (mitochondrion) (mitochondrion) [Asclepias syriaca] Length = 525 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >gb|EPS74621.1| cytochrome c oxidase subunit 1 [Genlisea aurea] Length = 528 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >gb|AGI48771.1| cytochrome c oxidase subunit 1 (mitochondrion) [Lolium perenne] Length = 662 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >dbj|BAD38494.1| cytochrome c oxidase subunit1 [Oryza sativa Japonica Group] Length = 525 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >ref|YP_588386.1| cytochrome c oxidase subunit 1 [Zea mays subsp. mays] gi|114151568|ref|YP_740353.1| cytochrome c oxidase subunit 1 [Zea perennis] gi|114151600|ref|YP_740448.1| cytochrome c oxidase subunit 1 [Zea luxurians] gi|114151634|ref|YP_740410.1| cytochrome c oxidase subunit 1 [Zea mays subsp. parviglumis] gi|1169027|sp|P08742.2|COX1_MAIZE RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I gi|12889|emb|CAA26496.1| unnamed protein product [Zea mays] gi|23452695|gb|AAN33123.1| cytochrome c oxidase subunit I [Zea mays] gi|40795003|gb|AAR91047.1| cytochrome c oxidase subunit 1 (mitochondrion) [Zea mays] gi|93116044|gb|ABE98677.1| cytochrome c oxidase subunit 1 (mitochondrion) [Zea mays subsp. mays] gi|93116088|gb|ABE98720.1| cytochrome c oxidase subunit 1 (mitochondrion) [Zea mays subsp. mays] gi|93116133|gb|ABE98764.1| cytochrome c oxidase subunit 1 [Zea mays subsp. mays] gi|102567902|gb|ABF70819.1| cytochrome c oxidase subunit 1 (mitochondrion) [Zea perennis] gi|102567967|gb|ABF70851.1| cytochrome c oxidase subunit 1 (mitochondrion) [Zea mays subsp. parviglumis] gi|102579637|gb|ABF70917.1| cytochrome c oxidase subunit 1 (mitochondrion) [Zea mays subsp. mays] gi|110287596|gb|ABG65642.1| cytochrome c oxidase subunit 1 (mitochondrion) [Zea luxurians] gi|414871178|tpg|DAA49735.1| TPA: cytochrome c oxidase subunit 1 [Zea mays] gi|224651|prf||1110159A oxidase I,cytochrome c Length = 528 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >ref|YP_514675.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|194033255|ref|YP_002000592.1| cytochrome c oxidase subunit1 (mitochondrion) [Oryza sativa Japonica Group] gi|1169030|sp|P14578.2|COX1_ORYSJ RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I gi|13219|emb|CAA34122.1| unnamed protein product (mitochondrion) [Oryza sativa] gi|23495416|dbj|BAC19897.1| Cytochrome c oxidase subunit1 (mitochondrion) [Oryza sativa Japonica Group] gi|74100117|gb|AAZ99281.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|74100172|gb|AAZ99335.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza sativa Japonica Group] gi|285026186|dbj|BAI68018.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|353685216|gb|AER12979.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|353685217|gb|AER12980.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|353685286|gb|AER13048.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|353685287|gb|AER13049.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|374277607|gb|AEZ03713.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|374277663|gb|AEZ03768.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|528540425|dbj|BAN67479.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza rufipogon] gi|528540467|dbj|BAN67520.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza rufipogon] gi|528540496|dbj|BAN67549.1| cytochrome c oxidase subunit 1 (mitochondrion) [Oryza rufipogon] Length = 524 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75 >ref|NP_064063.1| cox1 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435044|ref|YP_004222259.1| cytochrome c oxidase subunit 1 [Beta vulgaris subsp. maritima] gi|346683137|ref|YP_004842066.1| cytochrome c oxidase subunit 1 [Beta macrocarpa] gi|1352129|sp|P24794.2|COX1_BETVU RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I (mitochondrion) [Beta vulgaris] gi|11259|emb|CAA40874.1| coxI (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|6331674|dbj|BAA86630.1| cytohrome oxidase subunit I (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|9087311|dbj|BAA99455.1| cytochrome c oxidase subunit 1 (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|54606718|dbj|BAD66741.1| cytochrome oxidase subunit 1 (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|87248023|gb|ABD36066.1| cytochrome oxidase subunit 1 (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905697|emb|CBJ14088.1| cytochrome c oxidase subunit 1 [Beta vulgaris subsp. maritima] gi|319439777|emb|CBJ17497.1| cytochrome c oxidase subunit 1 [Beta vulgaris subsp. maritima] gi|345500055|emb|CBX24871.1| cytochrome c oxidase subunit 1 [Beta macrocarpa] gi|384939213|emb|CBL52059.1| cytochrome c oxidase subunit 1 (mitochondrion) [Beta vulgaris subsp. maritima] Length = 524 Score = 156 bits (394), Expect = 6e-36 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 227 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 48 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL Sbjct: 1 MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVL 60 Query: 47 ITAHAFLMIFFMVMP 3 ITAHAFLMIFFMVMP Sbjct: 61 ITAHAFLMIFFMVMP 75