BLASTX nr result
ID: Forsythia21_contig00052604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00052604 (313 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006377968.1| kinesin motor family protein [Populus tricho... 56 8e-06 >ref|XP_006377968.1| kinesin motor family protein [Populus trichocarpa] gi|550328574|gb|ERP55765.1| kinesin motor family protein [Populus trichocarpa] Length = 1129 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 310 VLQNVKEAGNTSVPEFRRSRSTPRGKFMVLP 218 V +N KEAGNTS+PEFRRSRSTPRGKF +LP Sbjct: 1099 VTRNAKEAGNTSMPEFRRSRSTPRGKFTILP 1129