BLASTX nr result
ID: Forsythia21_contig00052529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00052529 (268 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EUN24025.1| hypothetical protein COCVIDRAFT_107196 [Bipolaris... 116 7e-24 ref|XP_007689776.1| hypothetical protein COCMIDRAFT_100106 [Bipo... 116 7e-24 ref|XP_007716431.1| hypothetical protein COCCADRAFT_106963 [Bipo... 116 7e-24 gb|EMD97648.1| hypothetical protein COCHEDRAFT_1164756 [Bipolari... 116 7e-24 ref|XP_007704081.1| hypothetical protein COCSADRAFT_40433 [Bipol... 116 7e-24 ref|XP_001934498.1| monothiol glutaredoxin-5, mitochondrial prec... 114 2e-23 ref|XP_003835565.1| hypothetical protein LEMA_P049060.1 [Leptosp... 113 6e-23 ref|XP_001795352.1| hypothetical protein SNOG_04939 [Phaeosphaer... 112 1e-22 ref|XP_008021179.1| hypothetical protein SETTUDRAFT_162761 [Seto... 110 3e-22 gb|EKG21531.1| hypothetical protein MPH_01125 [Macrophomina phas... 108 1e-21 ref|XP_007778064.1| hypothetical protein W97_01972 [Coniosporium... 107 3e-21 gb|KIW05095.1| Grx4 family monothiol glutaredoxin [Verruconis ga... 106 7e-21 gb|EEH17134.1| Grx4 family monothiol glutaredoxin [Paracoccidioi... 105 9e-21 ref|XP_010760910.1| Grx4 family monothiol glutaredoxin [Paracocc... 105 9e-21 ref|XP_002790631.1| monothiol glutaredoxin-5 [Paracoccidioides s... 105 9e-21 ref|XP_007585007.1| putative monothiol glutaredoxin-5 protein [N... 105 1e-20 dbj|GAM84287.1| hypothetical protein ANO11243_022810 [fungal sp.... 105 2e-20 gb|KKK16588.1| monothiol glutaredoxin-5 [Aspergillus rambellii] ... 103 6e-20 gb|KIN06559.1| hypothetical protein OIDMADRAFT_50038 [Oidiodendr... 102 8e-20 ref|XP_003068178.1| Glutaredoxin family protein [Coccidioides po... 102 8e-20 >gb|EUN24025.1| hypothetical protein COCVIDRAFT_107196 [Bipolaris victoriae FI3] Length = 156 Score = 116 bits (290), Expect = 7e-24 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -1 Query: 268 QDLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPADGQ 98 Q+LRQGIKEYSEWPTIPQLYVDKEF+GGCDILM+MHQDGSLAKMLEEKGVVVPA+GQ Sbjct: 96 QELRQGIKEYSEWPTIPQLYVDKEFIGGCDILMTMHQDGSLAKMLEEKGVVVPAEGQ 152 >ref|XP_007689776.1| hypothetical protein COCMIDRAFT_100106 [Bipolaris oryzae ATCC 44560] gi|576930121|gb|EUC43710.1| hypothetical protein COCMIDRAFT_100106 [Bipolaris oryzae ATCC 44560] Length = 156 Score = 116 bits (290), Expect = 7e-24 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -1 Query: 268 QDLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPADGQ 98 Q+LRQGIKEYSEWPTIPQLYVDKEF+GGCDILM+MHQDGSLAKMLEEKGVVVPA+GQ Sbjct: 96 QELRQGIKEYSEWPTIPQLYVDKEFIGGCDILMTMHQDGSLAKMLEEKGVVVPAEGQ 152 >ref|XP_007716431.1| hypothetical protein COCCADRAFT_106963 [Bipolaris zeicola 26-R-13] gi|576914958|gb|EUC29283.1| hypothetical protein COCCADRAFT_106963 [Bipolaris zeicola 26-R-13] Length = 156 Score = 116 bits (290), Expect = 7e-24 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -1 Query: 268 QDLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPADGQ 98 Q+LRQGIKEYSEWPTIPQLYVDKEF+GGCDILM+MHQDGSLAKMLEEKGVVVPA+GQ Sbjct: 96 QELRQGIKEYSEWPTIPQLYVDKEFIGGCDILMTMHQDGSLAKMLEEKGVVVPAEGQ 152 >gb|EMD97648.1| hypothetical protein COCHEDRAFT_1164756 [Bipolaris maydis C5] gi|477585867|gb|ENI02954.1| hypothetical protein COCC4DRAFT_201242 [Bipolaris maydis ATCC 48331] Length = 156 Score = 116 bits (290), Expect = 7e-24 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -1 Query: 268 QDLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPADGQ 98 Q+LRQGIKEYSEWPTIPQLYVDKEF+GGCDILM+MHQDGSLAKMLEEKGVVVPA+GQ Sbjct: 96 QELRQGIKEYSEWPTIPQLYVDKEFIGGCDILMTMHQDGSLAKMLEEKGVVVPAEGQ 152 >ref|XP_007704081.1| hypothetical protein COCSADRAFT_40433 [Bipolaris sorokiniana ND90Pr] gi|451846686|gb|EMD59995.1| hypothetical protein COCSADRAFT_40433 [Bipolaris sorokiniana ND90Pr] Length = 156 Score = 116 bits (290), Expect = 7e-24 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -1 Query: 268 QDLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPADGQ 98 Q+LRQGIKEYSEWPTIPQLYVDKEF+GGCDILM+MHQDGSLAKMLEEKGVVVPA+GQ Sbjct: 96 QELRQGIKEYSEWPTIPQLYVDKEFIGGCDILMTMHQDGSLAKMLEEKGVVVPAEGQ 152 >ref|XP_001934498.1| monothiol glutaredoxin-5, mitochondrial precursor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330921652|ref|XP_003299511.1| hypothetical protein PTT_10516 [Pyrenophora teres f. teres 0-1] gi|187980377|gb|EDU47003.1| monothiol glutaredoxin-5, mitochondrial precursor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311326776|gb|EFQ92385.1| hypothetical protein PTT_10516 [Pyrenophora teres f. teres 0-1] Length = 154 Score = 114 bits (286), Expect = 2e-23 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = -1 Query: 268 QDLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPADGQAP 92 Q+LRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPA+ P Sbjct: 96 QELRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPAEQTPP 154 >ref|XP_003835565.1| hypothetical protein LEMA_P049060.1 [Leptosphaeria maculans JN3] gi|312212116|emb|CBX92200.1| hypothetical protein LEMA_P049060.1 [Leptosphaeria maculans JN3] Length = 156 Score = 113 bits (282), Expect = 6e-23 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = -1 Query: 268 QDLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPAD 104 Q+LRQGIKEYSEWPTIPQLYVDKEF+GGCDILMSMHQDGSLAKMLEEKGVVVPA+ Sbjct: 97 QELRQGIKEYSEWPTIPQLYVDKEFIGGCDILMSMHQDGSLAKMLEEKGVVVPAE 151 >ref|XP_001795352.1| hypothetical protein SNOG_04939 [Phaeosphaeria nodorum SN15] gi|111066210|gb|EAT87330.1| hypothetical protein SNOG_04939 [Phaeosphaeria nodorum SN15] Length = 157 Score = 112 bits (280), Expect = 1e-22 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = -1 Query: 268 QDLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPADGQ 98 Q+LR GIKEYSEWPTIPQLYV+KEF+GGCDILMSMHQDGSLAKMLEEKGVVVPA+G+ Sbjct: 98 QELRAGIKEYSEWPTIPQLYVEKEFIGGCDILMSMHQDGSLAKMLEEKGVVVPAEGE 154 >ref|XP_008021179.1| hypothetical protein SETTUDRAFT_162761 [Setosphaeria turcica Et28A] gi|482815669|gb|EOA92344.1| hypothetical protein SETTUDRAFT_162761 [Setosphaeria turcica Et28A] Length = 153 Score = 110 bits (276), Expect = 3e-22 Identities = 50/55 (90%), Positives = 55/55 (100%) Frame = -1 Query: 268 QDLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPAD 104 Q+LRQGIKEYSEWPTIPQLYVDKEF+GGCDILM+MHQDGSLAKMLEEKGV+VPA+ Sbjct: 96 QELRQGIKEYSEWPTIPQLYVDKEFIGGCDILMTMHQDGSLAKMLEEKGVLVPAE 150 >gb|EKG21531.1| hypothetical protein MPH_01125 [Macrophomina phaseolina MS6] Length = 159 Score = 108 bits (270), Expect = 1e-21 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -1 Query: 265 DLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPAD 104 +LRQGIKEYSEWPTIPQLYVD EFVGGCDILMSMHQDGSLAKMLEEKGV+VPA+ Sbjct: 100 ELRQGIKEYSEWPTIPQLYVDNEFVGGCDILMSMHQDGSLAKMLEEKGVLVPAE 153 >ref|XP_007778064.1| hypothetical protein W97_01972 [Coniosporium apollinis CBS 100218] gi|494825593|gb|EON62747.1| hypothetical protein W97_01972 [Coniosporium apollinis CBS 100218] Length = 178 Score = 107 bits (267), Expect = 3e-21 Identities = 49/55 (89%), Positives = 54/55 (98%) Frame = -1 Query: 268 QDLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPAD 104 ++LRQGIKEYSEWPTIPQLYV+KEFVGGCDILMSMHQDGSLAKMLEEK V+VPA+ Sbjct: 119 EELRQGIKEYSEWPTIPQLYVEKEFVGGCDILMSMHQDGSLAKMLEEKNVLVPAE 173 >gb|KIW05095.1| Grx4 family monothiol glutaredoxin [Verruconis gallopava] Length = 158 Score = 106 bits (264), Expect = 7e-21 Identities = 47/53 (88%), Positives = 53/53 (100%) Frame = -1 Query: 268 QDLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVP 110 Q+LRQGIKEYS+WPTIPQLYVDKEF+GGCDIL+SMHQDGSLAK+L+EKGVVVP Sbjct: 97 QELRQGIKEYSDWPTIPQLYVDKEFIGGCDILLSMHQDGSLAKLLQEKGVVVP 149 >gb|EEH17134.1| Grx4 family monothiol glutaredoxin [Paracoccidioides brasiliensis Pb03] Length = 159 Score = 105 bits (263), Expect = 9e-21 Identities = 45/57 (78%), Positives = 56/57 (98%) Frame = -1 Query: 265 DLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPADGQA 95 +LRQGIKEYS+WPTIPQ+Y+DKEF+GGCDILMSMHQ+G LAK+LEEKGV+VPA+G++ Sbjct: 99 ELRQGIKEYSDWPTIPQMYLDKEFIGGCDILMSMHQNGELAKLLEEKGVLVPAEGES 155 >ref|XP_010760910.1| Grx4 family monothiol glutaredoxin [Paracoccidioides brasiliensis Pb18] gi|226293684|gb|EEH49104.1| Grx4 family monothiol glutaredoxin [Paracoccidioides brasiliensis Pb18] Length = 159 Score = 105 bits (263), Expect = 9e-21 Identities = 45/57 (78%), Positives = 56/57 (98%) Frame = -1 Query: 265 DLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPADGQA 95 +LRQGIKEYS+WPTIPQ+Y+DKEF+GGCDILMSMHQ+G LAK+LEEKGV+VPA+G++ Sbjct: 99 ELRQGIKEYSDWPTIPQMYLDKEFIGGCDILMSMHQNGELAKLLEEKGVLVPAEGES 155 >ref|XP_002790631.1| monothiol glutaredoxin-5 [Paracoccidioides sp. 'lutzii' Pb01] gi|226281506|gb|EEH37072.1| monothiol glutaredoxin-5 [Paracoccidioides sp. 'lutzii' Pb01] Length = 159 Score = 105 bits (263), Expect = 9e-21 Identities = 45/57 (78%), Positives = 56/57 (98%) Frame = -1 Query: 265 DLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPADGQA 95 +LRQGIKEYS+WPTIPQ+Y+DKEF+GGCDILMSMHQ+G LAK+LEEKGV+VPA+G++ Sbjct: 99 ELRQGIKEYSDWPTIPQMYLDKEFIGGCDILMSMHQNGELAKLLEEKGVLVPAEGES 155 >ref|XP_007585007.1| putative monothiol glutaredoxin-5 protein [Neofusicoccum parvum UCRNP2] gi|485921893|gb|EOD47506.1| putative monothiol glutaredoxin-5 protein [Neofusicoccum parvum UCRNP2] Length = 159 Score = 105 bits (262), Expect = 1e-20 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = -1 Query: 265 DLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPAD 104 +LR GIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEK V+VPA+ Sbjct: 100 ELRAGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKDVLVPAE 153 >dbj|GAM84287.1| hypothetical protein ANO11243_022810 [fungal sp. No.11243] Length = 153 Score = 105 bits (261), Expect = 2e-20 Identities = 48/59 (81%), Positives = 54/59 (91%) Frame = -1 Query: 268 QDLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPADGQAP 92 Q+LRQGIKEYS+WPTIPQLYVDKEFVGG DILMSMHQDGSLA++ E+KGV+V DG AP Sbjct: 94 QELRQGIKEYSDWPTIPQLYVDKEFVGGTDILMSMHQDGSLAELFEQKGVLVAEDGSAP 152 >gb|KKK16588.1| monothiol glutaredoxin-5 [Aspergillus rambellii] gi|816348857|gb|KKK24251.1| monothiol glutaredoxin-5 [Aspergillus ochraceoroseus] Length = 143 Score = 103 bits (256), Expect = 6e-20 Identities = 46/54 (85%), Positives = 53/54 (98%) Frame = -1 Query: 265 DLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPAD 104 +LRQGIKEYS+WPTIPQLY++KEFVGGCDILMSMHQ+G LAKMLEEKGV+VPA+ Sbjct: 90 ELRQGIKEYSDWPTIPQLYLEKEFVGGCDILMSMHQNGELAKMLEEKGVLVPAE 143 >gb|KIN06559.1| hypothetical protein OIDMADRAFT_50038 [Oidiodendron maius Zn] Length = 155 Score = 102 bits (255), Expect = 8e-20 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -1 Query: 262 LRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPADG 101 LRQGIKEYSEWPTIPQLYVDKEFVGGCDIL++MHQ+G LAKMLEEK V+VPA+G Sbjct: 98 LRQGIKEYSEWPTIPQLYVDKEFVGGCDILVAMHQNGELAKMLEEKKVLVPAEG 151 >ref|XP_003068178.1| Glutaredoxin family protein [Coccidioides posadasii C735 delta SOWgp] gi|240107859|gb|EER26033.1| Glutaredoxin family protein [Coccidioides posadasii C735 delta SOWgp] gi|320037915|gb|EFW19851.1| glutaredoxin [Coccidioides posadasii str. Silveira] Length = 152 Score = 102 bits (255), Expect = 8e-20 Identities = 44/57 (77%), Positives = 54/57 (94%) Frame = -1 Query: 265 DLRQGIKEYSEWPTIPQLYVDKEFVGGCDILMSMHQDGSLAKMLEEKGVVVPADGQA 95 +LRQGIKEYS+WPTIPQL++DKEF+GGCDILMSMHQ+G LAK+LEEKGV+VP + +A Sbjct: 94 ELRQGIKEYSDWPTIPQLFIDKEFIGGCDILMSMHQNGDLAKLLEEKGVLVPRESEA 150