BLASTX nr result
ID: Forsythia21_contig00052336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00052336 (257 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM96088.1| hypothetical protein AMTR_s04653p00000520, partia... 46 4e-06 >gb|ERM96088.1| hypothetical protein AMTR_s04653p00000520, partial [Amborella trichopoda] Length = 563 Score = 46.2 bits (108), Expect(2) = 4e-06 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -1 Query: 257 AYHGVLGRPALKELWAITSIHHLYMKFPTEGG 162 AY+ V+GRP LKE+ +TSI+HL MKFPT G Sbjct: 363 AYNAVIGRPILKEMKIVTSIYHLTMKFPTPSG 394 Score = 30.8 bits (68), Expect(2) = 4e-06 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = -3 Query: 177 PNGGGVATIRGNQPEARKCYRNALRKAEKRE 85 P GV ++RG Q ++R+CY A++ K++ Sbjct: 390 PTPSGVGSVRGVQSDSRECYNAAVKARRKKD 420