BLASTX nr result
ID: Forsythia21_contig00052102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00052102 (603 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ49160.1| protection of telomeres 1 protein [Helianthus arg... 72 2e-10 emb|CDP16693.1| unnamed protein product [Coffea canephora] 72 3e-10 ref|XP_010271004.1| PREDICTED: protection of telomeres protein 1... 71 5e-10 ref|XP_010271003.1| PREDICTED: protection of telomeres protein 1... 71 5e-10 ref|XP_010271002.1| PREDICTED: protection of telomeres protein 1... 71 5e-10 ref|XP_010271001.1| PREDICTED: protection of telomeres protein 1... 71 5e-10 gb|ACJ49167.1| protection of telomeres 1 protein [Gossypium hirs... 68 4e-09 ref|XP_010274733.1| PREDICTED: protection of telomeres protein 1... 67 5e-09 ref|XP_012471206.1| PREDICTED: protection of telomeres protein 1... 67 9e-09 gb|KJB08466.1| hypothetical protein B456_001G082700 [Gossypium r... 67 9e-09 gb|KJB08465.1| hypothetical protein B456_001G082700 [Gossypium r... 67 9e-09 gb|KJB08464.1| hypothetical protein B456_001G082700 [Gossypium r... 67 9e-09 ref|XP_009620675.1| PREDICTED: protection of telomeres protein 1... 67 9e-09 ref|XP_009620674.1| PREDICTED: protection of telomeres protein 1... 67 9e-09 ref|XP_009620673.1| PREDICTED: protection of telomeres protein 1... 67 9e-09 gb|ACJ49170.1| protection of telomeres 1 protein [Nicotiana taba... 67 9e-09 ref|XP_009800141.1| PREDICTED: protection of telomeres protein 1... 66 1e-08 ref|XP_009800140.1| PREDICTED: protection of telomeres protein 1... 66 1e-08 ref|XP_012471215.1| PREDICTED: protection of telomeres protein 1... 66 1e-08 ref|XP_010663684.1| PREDICTED: protection of telomeres protein 1... 65 2e-08 >gb|ACJ49160.1| protection of telomeres 1 protein [Helianthus argophyllus] Length = 467 Score = 72.0 bits (175), Expect = 2e-10 Identities = 31/51 (60%), Positives = 40/51 (78%) Frame = -3 Query: 598 SQHVVSLEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 S +SL+DI+ L+CKVLHVCEV G+W+LFVWDGTDAPP++I+TK Sbjct: 157 SNDFLSLKDIKQGNQSTLICKVLHVCEVKDGEWLLFVWDGTDAPPVNIHTK 207 >emb|CDP16693.1| unnamed protein product [Coffea canephora] Length = 448 Score = 71.6 bits (174), Expect = 3e-10 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = -3 Query: 598 SQHVVSLEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISI 455 S + V L+DI+G F+DLVC VLH+CE+S+ WMLFVWDGTDAP + + Sbjct: 146 SDYAVLLKDIKGHEFIDLVCMVLHLCEISNDNWMLFVWDGTDAPALHL 193 >ref|XP_010271004.1| PREDICTED: protection of telomeres protein 1b-like isoform X4 [Nelumbo nucifera] gi|720048056|ref|XP_010271005.1| PREDICTED: protection of telomeres protein 1b-like isoform X4 [Nelumbo nucifera] Length = 379 Score = 70.9 bits (172), Expect = 5e-10 Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = -3 Query: 598 SQHVVSLEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 S+++ SL+DIE F DL+CKVL+V E S +W+LFVWDGTD PP+S+ TK Sbjct: 66 SEYLRSLKDIEAGKFFDLICKVLYVYEASKDEWILFVWDGTDTPPLSLETK 116 >ref|XP_010271003.1| PREDICTED: protection of telomeres protein 1a-like isoform X3 [Nelumbo nucifera] Length = 464 Score = 70.9 bits (172), Expect = 5e-10 Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = -3 Query: 598 SQHVVSLEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 S+++ SL+DIE F DL+CKVL+V E S +W+LFVWDGTD PP+S+ TK Sbjct: 151 SEYLRSLKDIEAGKFFDLICKVLYVYEASKDEWILFVWDGTDTPPLSLETK 201 >ref|XP_010271002.1| PREDICTED: protection of telomeres protein 1a-like isoform X2 [Nelumbo nucifera] Length = 485 Score = 70.9 bits (172), Expect = 5e-10 Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = -3 Query: 598 SQHVVSLEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 S+++ SL+DIE F DL+CKVL+V E S +W+LFVWDGTD PP+S+ TK Sbjct: 173 SEYLRSLKDIEAGKFFDLICKVLYVYEASKDEWILFVWDGTDTPPLSLETK 223 >ref|XP_010271001.1| PREDICTED: protection of telomeres protein 1a-like isoform X1 [Nelumbo nucifera] Length = 486 Score = 70.9 bits (172), Expect = 5e-10 Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = -3 Query: 598 SQHVVSLEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 S+++ SL+DIE F DL+CKVL+V E S +W+LFVWDGTD PP+S+ TK Sbjct: 173 SEYLRSLKDIEAGKFFDLICKVLYVYEASKDEWILFVWDGTDTPPLSLETK 223 >gb|ACJ49167.1| protection of telomeres 1 protein [Gossypium hirsutum] Length = 460 Score = 67.8 bits (164), Expect = 4e-09 Identities = 31/57 (54%), Positives = 38/57 (66%), Gaps = 6/57 (10%) Frame = -3 Query: 598 SQHVVS------LEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 S HV+ LE+I V+LVCKVLH+C+ + KWM F+WDGTDAPPISI K Sbjct: 150 SSHVIDEPNFSLLEEINEVGLVNLVCKVLHICKTTDDKWMAFIWDGTDAPPISIYKK 206 >ref|XP_010274733.1| PREDICTED: protection of telomeres protein 1b-like [Nelumbo nucifera] Length = 464 Score = 67.4 bits (163), Expect = 5e-09 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 568 EGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 EG F DLVCK+LH+CE+S G+WMLFVWDGTD PP+ TK Sbjct: 164 EGLRF-DLVCKILHICELSKGEWMLFVWDGTDTPPLCFETK 203 >ref|XP_012471206.1| PREDICTED: protection of telomeres protein 1b-like isoform X1 [Gossypium raimondii] gi|763740968|gb|KJB08467.1| hypothetical protein B456_001G082700 [Gossypium raimondii] Length = 450 Score = 66.6 bits (161), Expect = 9e-09 Identities = 30/57 (52%), Positives = 38/57 (66%), Gaps = 6/57 (10%) Frame = -3 Query: 598 SQHVVS------LEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 S HV+ LE+I V+LVC+VLH+C+ + KWM F+WDGTDAPPISI K Sbjct: 140 SSHVIDEPNFSLLEEINEVGLVNLVCRVLHICKTTDDKWMAFIWDGTDAPPISIYKK 196 >gb|KJB08466.1| hypothetical protein B456_001G082700 [Gossypium raimondii] Length = 321 Score = 66.6 bits (161), Expect = 9e-09 Identities = 30/57 (52%), Positives = 38/57 (66%), Gaps = 6/57 (10%) Frame = -3 Query: 598 SQHVVS------LEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 S HV+ LE+I V+LVC+VLH+C+ + KWM F+WDGTDAPPISI K Sbjct: 140 SSHVIDEPNFSLLEEINEVGLVNLVCRVLHICKTTDDKWMAFIWDGTDAPPISIYKK 196 >gb|KJB08465.1| hypothetical protein B456_001G082700 [Gossypium raimondii] Length = 318 Score = 66.6 bits (161), Expect = 9e-09 Identities = 30/57 (52%), Positives = 38/57 (66%), Gaps = 6/57 (10%) Frame = -3 Query: 598 SQHVVS------LEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 S HV+ LE+I V+LVC+VLH+C+ + KWM F+WDGTDAPPISI K Sbjct: 140 SSHVIDEPNFSLLEEINEVGLVNLVCRVLHICKTTDDKWMAFIWDGTDAPPISIYKK 196 >gb|KJB08464.1| hypothetical protein B456_001G082700 [Gossypium raimondii] Length = 320 Score = 66.6 bits (161), Expect = 9e-09 Identities = 30/57 (52%), Positives = 38/57 (66%), Gaps = 6/57 (10%) Frame = -3 Query: 598 SQHVVS------LEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 S HV+ LE+I V+LVC+VLH+C+ + KWM F+WDGTDAPPISI K Sbjct: 140 SSHVIDEPNFSLLEEINEVGLVNLVCRVLHICKTTDDKWMAFIWDGTDAPPISIYKK 196 >ref|XP_009620675.1| PREDICTED: protection of telomeres protein 1b isoform X3 [Nicotiana tomentosiformis] Length = 422 Score = 66.6 bits (161), Expect = 9e-09 Identities = 30/47 (63%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -3 Query: 583 SLEDI-EGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 SL++I EG+ F +L+CK+LHVCEV KWML VWDGTD PP++I TK Sbjct: 167 SLKEIREGERF-NLICKILHVCEVEKDKWMLLVWDGTDTPPVTIKTK 212 >ref|XP_009620674.1| PREDICTED: protection of telomeres protein 1b isoform X2 [Nicotiana tomentosiformis] Length = 466 Score = 66.6 bits (161), Expect = 9e-09 Identities = 30/47 (63%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -3 Query: 583 SLEDI-EGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 SL++I EG+ F +L+CK+LHVCEV KWML VWDGTD PP++I TK Sbjct: 160 SLKEIREGERF-NLICKILHVCEVEKDKWMLLVWDGTDTPPVTIKTK 205 >ref|XP_009620673.1| PREDICTED: protection of telomeres protein 1b isoform X1 [Nicotiana tomentosiformis] Length = 473 Score = 66.6 bits (161), Expect = 9e-09 Identities = 30/47 (63%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -3 Query: 583 SLEDI-EGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 SL++I EG+ F +L+CK+LHVCEV KWML VWDGTD PP++I TK Sbjct: 167 SLKEIREGERF-NLICKILHVCEVEKDKWMLLVWDGTDTPPVTIKTK 212 >gb|ACJ49170.1| protection of telomeres 1 protein [Nicotiana tabacum] Length = 466 Score = 66.6 bits (161), Expect = 9e-09 Identities = 30/47 (63%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -3 Query: 583 SLEDI-EGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 SL++I EG+ F +L+CK+LHVCEV KWML VWDGTD PP++I TK Sbjct: 160 SLKEIREGERF-NLICKILHVCEVEKDKWMLLVWDGTDTPPVTIKTK 205 >ref|XP_009800141.1| PREDICTED: protection of telomeres protein 1b-like isoform X2 [Nicotiana sylvestris] Length = 354 Score = 66.2 bits (160), Expect = 1e-08 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -3 Query: 583 SLEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 SL++I +L+CK+LH+CEV KWML VWDGTD PP++I TK Sbjct: 160 SLKEIREGEHFNLICKILHICEVEKDKWMLLVWDGTDTPPVTIKTK 205 >ref|XP_009800140.1| PREDICTED: protection of telomeres protein 1b-like isoform X1 [Nicotiana sylvestris] Length = 466 Score = 66.2 bits (160), Expect = 1e-08 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -3 Query: 583 SLEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 SL++I +L+CK+LH+CEV KWML VWDGTD PP++I TK Sbjct: 160 SLKEIREGEHFNLICKILHICEVEKDKWMLLVWDGTDTPPVTIKTK 205 >ref|XP_012471215.1| PREDICTED: protection of telomeres protein 1a-like isoform X2 [Gossypium raimondii] Length = 437 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -3 Query: 580 LEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINTK 446 LE+I V+LVC+VLH+C+ + KWM F+WDGTDAPPISI K Sbjct: 139 LEEINEVGLVNLVCRVLHICKTTDDKWMAFIWDGTDAPPISIYKK 183 >ref|XP_010663684.1| PREDICTED: protection of telomeres protein 1a-like isoform X2 [Vitis vinifera] Length = 376 Score = 65.5 bits (158), Expect = 2e-08 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = -3 Query: 586 VSLEDIEGKAFVDLVCKVLHVCEVSSGKWMLFVWDGTDAPPISINT 449 +SL +I VDL CK+LH+CEV+ +W++FVWDGTD PP+S+ T Sbjct: 69 LSLREIREGERVDLFCKILHICEVTKDEWIIFVWDGTDTPPVSVQT 114