BLASTX nr result
ID: Forsythia21_contig00051917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00051917 (522 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089782.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 ref|XP_011089777.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 ref|XP_009764400.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_006347148.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_009612771.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 >ref|XP_011089782.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 isoform X2 [Sesamum indicum] Length = 1023 Score = 63.5 bits (153), Expect = 5e-08 Identities = 43/132 (32%), Positives = 59/132 (44%), Gaps = 1/132 (0%) Frame = -2 Query: 473 LRLYGSSAHFLLRRFSLKIPSKFIYERRQCCEAPILNXXXXXXXXXXXXFDEIPATENVQ 294 +R+ S HF L R L + SKF ++ Q C P DE P ENV Sbjct: 45 VRIRKSLVHFSLHRLWLNVSSKFFHKWHQSCRVPTSTFAAFSSSAASCVLDEAPTEENVH 104 Query: 293 KIE-ISSGTKKTCILQSSSLREIPLRYGTDYSRIIDECLQLVSLLDAKKLQAKSLKLGLH 117 I S KK +L +EI T + D+CL++ DAK Q + L+ LH Sbjct: 105 SFAGIHSELKKGNVLCFDWQQEIHRTPPTYRESLRDKCLEIRCSPDAKNFQGEDLRTLLH 164 Query: 116 EDNGISNRLAEV 81 E GIS +LA++ Sbjct: 165 ESGGISGQLADI 176 >ref|XP_011089777.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 isoform X1 [Sesamum indicum] gi|747084712|ref|XP_011089778.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 isoform X1 [Sesamum indicum] gi|747084714|ref|XP_011089779.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 isoform X1 [Sesamum indicum] gi|747084716|ref|XP_011089780.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 isoform X1 [Sesamum indicum] Length = 1054 Score = 63.5 bits (153), Expect = 5e-08 Identities = 43/132 (32%), Positives = 59/132 (44%), Gaps = 1/132 (0%) Frame = -2 Query: 473 LRLYGSSAHFLLRRFSLKIPSKFIYERRQCCEAPILNXXXXXXXXXXXXFDEIPATENVQ 294 +R+ S HF L R L + SKF ++ Q C P DE P ENV Sbjct: 45 VRIRKSLVHFSLHRLWLNVSSKFFHKWHQSCRVPTSTFAAFSSSAASCVLDEAPTEENVH 104 Query: 293 KIE-ISSGTKKTCILQSSSLREIPLRYGTDYSRIIDECLQLVSLLDAKKLQAKSLKLGLH 117 I S KK +L +EI T + D+CL++ DAK Q + L+ LH Sbjct: 105 SFAGIHSELKKGNVLCFDWQQEIHRTPPTYRESLRDKCLEIRCSPDAKNFQGEDLRTLLH 164 Query: 116 EDNGISNRLAEV 81 E GIS +LA++ Sbjct: 165 ESGGISGQLADI 176 >ref|XP_009764400.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Nicotiana sylvestris] gi|698536113|ref|XP_009764401.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Nicotiana sylvestris] gi|698536116|ref|XP_009764402.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Nicotiana sylvestris] gi|698536119|ref|XP_009764403.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Nicotiana sylvestris] gi|698536122|ref|XP_009764404.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Nicotiana sylvestris] gi|698536124|ref|XP_009764405.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Nicotiana sylvestris] Length = 1059 Score = 63.2 bits (152), Expect = 7e-08 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 1/71 (1%) Frame = -2 Query: 212 TDYSRIIDECLQLVSLLDAKKLQAKSLKLGLHEDNGISNRLAEVYTAAGEIDCALQILDG 33 T Y ++D CL S++DAKKL K LKLG D IS R ++Y A G++ ALQI D Sbjct: 77 TYYLSLLDSCLSEGSIIDAKKLHGKLLKLGFGSDYRISARFLDIYVAGGDLSSALQIFDN 136 Query: 32 FPAS-RNSSPW 3 P+ RN S W Sbjct: 137 LPSGIRNVSCW 147 >ref|XP_006347148.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Solanum tuberosum] Length = 1057 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/71 (45%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = -2 Query: 212 TDYSRIIDECLQLVSLLDAKKLQAKSLKLGLHEDNGISNRLAEVYTAAGEIDCALQILDG 33 T Y ++D CL S++DAKKLQ K L LG +D I R ++Y A G++ ALQI D Sbjct: 75 TYYLSLLDCCLSEGSIVDAKKLQGKLLTLGFGDDYRIGARFLDIYVAGGDLSSALQIFDN 134 Query: 32 FPAS-RNSSPW 3 P RN S W Sbjct: 135 LPIGIRNVSCW 145 >ref|XP_009612771.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Nicotiana tomentosiformis] gi|697117658|ref|XP_009612772.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Nicotiana tomentosiformis] Length = 1067 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/71 (43%), Positives = 42/71 (59%), Gaps = 1/71 (1%) Frame = -2 Query: 212 TDYSRIIDECLQLVSLLDAKKLQAKSLKLGLHEDNGISNRLAEVYTAAGEIDCALQILDG 33 T Y ++D CL S++DAKKL K LKLG D I+ R ++Y A G++ ALQI D Sbjct: 77 TYYLSLLDSCLSEESIVDAKKLLGKLLKLGFGSDYWIAARFLDIYVAGGDLSGALQIFDN 136 Query: 32 FPAS-RNSSPW 3 P+ +N S W Sbjct: 137 LPSRIKNVSCW 147