BLASTX nr result
ID: Forsythia21_contig00051662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00051662 (258 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094207.1| PREDICTED: calcium-transporting ATPase, endo... 99 9e-19 emb|CDP08644.1| unnamed protein product [Coffea canephora] 97 4e-18 ref|XP_012843886.1| PREDICTED: LOW QUALITY PROTEIN: calcium-tran... 96 1e-17 gb|EYU32279.1| hypothetical protein MIMGU_mgv1a000676mg [Erythra... 96 1e-17 ref|XP_008233097.1| PREDICTED: calcium-transporting ATPase, endo... 92 1e-16 ref|XP_007220597.1| hypothetical protein PRUPE_ppa000654mg [Prun... 92 1e-16 ref|XP_002523298.1| calcium-transporting atpase 4, endoplasmic r... 92 1e-16 ref|XP_008790538.1| PREDICTED: calcium-transporting ATPase, endo... 91 2e-16 ref|XP_007135282.1| hypothetical protein PHAVU_010G116200g [Phas... 91 2e-16 ref|XP_003548255.1| PREDICTED: calcium-transporting ATPase, endo... 91 2e-16 ref|XP_010100698.1| Calcium-transporting ATPase, endoplasmic ret... 91 4e-16 ref|XP_011038641.1| PREDICTED: calcium-transporting ATPase, endo... 91 4e-16 ref|XP_002320213.1| Calcium-transporting ATPase 2 family protein... 91 4e-16 ref|XP_010267484.1| PREDICTED: calcium-transporting ATPase, endo... 90 5e-16 ref|XP_010693884.1| PREDICTED: calcium-transporting ATPase, endo... 89 9e-16 ref|XP_006444784.1| hypothetical protein CICLE_v10018638mg [Citr... 89 1e-15 ref|XP_006444783.1| hypothetical protein CICLE_v10018638mg [Citr... 89 1e-15 ref|NP_001234073.1| calcium-transporting ATPase, endoplasmic ret... 89 1e-15 gb|KHG03262.1| Calcium-transporting ATPase, endoplasmic reticulu... 89 2e-15 emb|CBI40589.3| unnamed protein product [Vitis vinifera] 88 2e-15 >ref|XP_011094207.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Sesamum indicum] Length = 1051 Score = 99.4 bits (246), Expect = 9e-19 Identities = 42/56 (75%), Positives = 52/56 (92%) Frame = -1 Query: 168 MEETVNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 M+E V++K FKAWSW VEQCL+EYKVKLDKGLS+++V+KRRE +GWN+LQKEKGKP Sbjct: 1 MKEIVDQKPFKAWSWSVEQCLKEYKVKLDKGLSSFEVEKRRETFGWNQLQKEKGKP 56 >emb|CDP08644.1| unnamed protein product [Coffea canephora] Length = 1054 Score = 97.1 bits (240), Expect = 4e-18 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = -1 Query: 168 MEETVNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 M+ + +EK F AWSWPVEQCL+EY VK+DKGLSTY+V+KR E YGWNELQKE+GKP Sbjct: 1 MDPSADEKPFHAWSWPVEQCLKEYSVKIDKGLSTYEVEKRLEKYGWNELQKERGKP 56 >ref|XP_012843886.1| PREDICTED: LOW QUALITY PROTEIN: calcium-transporting ATPase, endoplasmic reticulum-type [Erythranthe guttatus] Length = 1054 Score = 95.9 bits (237), Expect = 1e-17 Identities = 44/56 (78%), Positives = 49/56 (87%) Frame = -1 Query: 168 MEETVNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 MEE V E FKAWSW VEQCL+EYKVKLDKGLSTY+ +KRRE +GWNELQKE+GKP Sbjct: 1 MEEIV-ETPFKAWSWSVEQCLKEYKVKLDKGLSTYEAEKRRETFGWNELQKEQGKP 55 >gb|EYU32279.1| hypothetical protein MIMGU_mgv1a000676mg [Erythranthe guttata] Length = 1022 Score = 95.9 bits (237), Expect = 1e-17 Identities = 44/56 (78%), Positives = 49/56 (87%) Frame = -1 Query: 168 MEETVNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 MEE V E FKAWSW VEQCL+EYKVKLDKGLSTY+ +KRRE +GWNELQKE+GKP Sbjct: 1 MEEIV-ETPFKAWSWSVEQCLKEYKVKLDKGLSTYEAEKRRETFGWNELQKEQGKP 55 >ref|XP_008233097.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Prunus mume] gi|645254567|ref|XP_008233098.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Prunus mume] Length = 1051 Score = 92.4 bits (228), Expect = 1e-16 Identities = 40/52 (76%), Positives = 44/52 (84%) Frame = -1 Query: 156 VNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 + EK AWSWPVEQCL+EY VKLDKGLSTY+ +KRRE YGWNEL KEKGKP Sbjct: 1 MEEKPVPAWSWPVEQCLKEYHVKLDKGLSTYEAEKRRERYGWNELSKEKGKP 52 >ref|XP_007220597.1| hypothetical protein PRUPE_ppa000654mg [Prunus persica] gi|462417059|gb|EMJ21796.1| hypothetical protein PRUPE_ppa000654mg [Prunus persica] Length = 1051 Score = 92.4 bits (228), Expect = 1e-16 Identities = 40/52 (76%), Positives = 44/52 (84%) Frame = -1 Query: 156 VNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 + EK AWSWPVEQCL+EY VKLDKGLSTY+ +KRRE YGWNEL KEKGKP Sbjct: 1 MEEKPVPAWSWPVEQCLKEYHVKLDKGLSTYEAEKRRERYGWNELSKEKGKP 52 >ref|XP_002523298.1| calcium-transporting atpase 4, endoplasmic reticulum-type, putative [Ricinus communis] gi|223537386|gb|EEF39014.1| calcium-transporting atpase 4, endoplasmic reticulum-type, putative [Ricinus communis] Length = 330 Score = 92.0 bits (227), Expect = 1e-16 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -1 Query: 156 VNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 + EK F AWSW VEQCL+EY VKLDKGLS+Y+V+KRRE YGWNEL KEKGKP Sbjct: 1 MEEKPFPAWSWSVEQCLKEYNVKLDKGLSSYEVEKRRERYGWNELAKEKGKP 52 >ref|XP_008790538.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Phoenix dactylifera] Length = 1050 Score = 91.3 bits (225), Expect = 2e-16 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = -1 Query: 156 VNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 + EK F AWSW VEQCL+EY VKL+KGLS+Y+V+KRRE YGWNEL+KEKGKP Sbjct: 1 MEEKPFPAWSWSVEQCLKEYNVKLEKGLSSYEVEKRRERYGWNELRKEKGKP 52 >ref|XP_007135282.1| hypothetical protein PHAVU_010G116200g [Phaseolus vulgaris] gi|593266210|ref|XP_007135283.1| hypothetical protein PHAVU_010G116200g [Phaseolus vulgaris] gi|561008327|gb|ESW07276.1| hypothetical protein PHAVU_010G116200g [Phaseolus vulgaris] gi|561008328|gb|ESW07277.1| hypothetical protein PHAVU_010G116200g [Phaseolus vulgaris] Length = 1052 Score = 91.3 bits (225), Expect = 2e-16 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -1 Query: 156 VNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 + EK F AWSW VEQCL+EY+VKLDKGLST++V KRRE YGWNEL KEKGKP Sbjct: 1 MEEKPFPAWSWSVEQCLKEYEVKLDKGLSTHEVQKRREKYGWNELAKEKGKP 52 >ref|XP_003548255.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type-like isoform X1 [Glycine max] gi|571524929|ref|XP_006598889.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type-like isoform X2 [Glycine max] gi|734361967|gb|KHN15910.1| Calcium-transporting ATPase, endoplasmic reticulum-type [Glycine soja] Length = 1057 Score = 91.3 bits (225), Expect = 2e-16 Identities = 41/56 (73%), Positives = 46/56 (82%) Frame = -1 Query: 168 MEETVNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 M+ ++ EK F AWSW VEQCL+EY VKLDKGLSTY+V KR E YGWNEL KEKGKP Sbjct: 1 MKVSMEEKPFPAWSWSVEQCLKEYGVKLDKGLSTYEVQKRLEKYGWNELAKEKGKP 56 >ref|XP_010100698.1| Calcium-transporting ATPase, endoplasmic reticulum-type [Morus notabilis] gi|587895359|gb|EXB83860.1| Calcium-transporting ATPase, endoplasmic reticulum-type [Morus notabilis] Length = 1050 Score = 90.5 bits (223), Expect = 4e-16 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -1 Query: 156 VNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 + EK F AWSW VEQCL+EY VKL+KGLS+Y+V+KRRE YGWNEL KEKGKP Sbjct: 1 MEEKPFPAWSWSVEQCLKEYNVKLEKGLSSYEVEKRRERYGWNELAKEKGKP 52 >ref|XP_011038641.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Populus euphratica] gi|743790328|ref|XP_011038651.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Populus euphratica] Length = 1051 Score = 90.5 bits (223), Expect = 4e-16 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -1 Query: 156 VNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 + EK F AWSW VEQCL+E+ VKLDKGLS+Y+V+KRRE YGWNEL KEKGKP Sbjct: 1 MEEKPFPAWSWSVEQCLKEFNVKLDKGLSSYEVEKRRERYGWNELAKEKGKP 52 >ref|XP_002320213.1| Calcium-transporting ATPase 2 family protein [Populus trichocarpa] gi|222860986|gb|EEE98528.1| Calcium-transporting ATPase 2 family protein [Populus trichocarpa] Length = 1045 Score = 90.5 bits (223), Expect = 4e-16 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -1 Query: 156 VNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 + EK F AWSW VEQCL+E+ VKLDKGLS+Y+V+KRRE YGWNEL KEKGKP Sbjct: 1 MEEKPFPAWSWSVEQCLKEFNVKLDKGLSSYEVEKRRERYGWNELAKEKGKP 52 >ref|XP_010267484.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Nelumbo nucifera] gi|720036837|ref|XP_010267485.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Nelumbo nucifera] gi|720036841|ref|XP_010267486.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Nelumbo nucifera] gi|720036844|ref|XP_010267487.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Nelumbo nucifera] Length = 1053 Score = 90.1 bits (222), Expect = 5e-16 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = -1 Query: 156 VNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 + EK F AWSW VE+CL+EY VKL+KGLS+Y+V+KRRE YGWNEL+KEKGKP Sbjct: 1 MEEKPFPAWSWSVERCLKEYSVKLEKGLSSYEVEKRRERYGWNELEKEKGKP 52 >ref|XP_010693884.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Beta vulgaris subsp. vulgaris] gi|870869513|gb|KMT20258.1| hypothetical protein BVRB_1g002620 [Beta vulgaris subsp. vulgaris] Length = 1059 Score = 89.4 bits (220), Expect = 9e-16 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = -1 Query: 159 TVNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 ++ EK F AWSW VE+CL+EY VKLDKGLS+YDV+K RE YGWNEL KEKGKP Sbjct: 6 SMEEKPFFAWSWSVERCLKEYNVKLDKGLSSYDVEKLRERYGWNELDKEKGKP 58 >ref|XP_006444784.1| hypothetical protein CICLE_v10018638mg [Citrus clementina] gi|568876523|ref|XP_006491327.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type-like [Citrus sinensis] gi|557547046|gb|ESR58024.1| hypothetical protein CICLE_v10018638mg [Citrus clementina] gi|641867866|gb|KDO86550.1| hypothetical protein CISIN_1g001568mg [Citrus sinensis] Length = 1051 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -1 Query: 156 VNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 + EK F AWSW VEQCL+EY VKLDKGLS+ +V+KRRE YGWNEL KEKGKP Sbjct: 1 MEEKPFPAWSWTVEQCLKEYNVKLDKGLSSREVEKRRERYGWNELDKEKGKP 52 >ref|XP_006444783.1| hypothetical protein CICLE_v10018638mg [Citrus clementina] gi|557547045|gb|ESR58023.1| hypothetical protein CICLE_v10018638mg [Citrus clementina] gi|641867867|gb|KDO86551.1| hypothetical protein CISIN_1g001568mg [Citrus sinensis] gi|641867868|gb|KDO86552.1| hypothetical protein CISIN_1g001568mg [Citrus sinensis] Length = 753 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -1 Query: 156 VNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 + EK F AWSW VEQCL+EY VKLDKGLS+ +V+KRRE YGWNEL KEKGKP Sbjct: 1 MEEKPFPAWSWTVEQCLKEYNVKLDKGLSSREVEKRRERYGWNELDKEKGKP 52 >ref|NP_001234073.1| calcium-transporting ATPase, endoplasmic reticulum-type [Solanum lycopersicum] gi|723659583|ref|XP_010323817.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type isoform X1 [Solanum lycopersicum] gi|723659586|ref|XP_010323824.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type isoform X1 [Solanum lycopersicum] gi|723659589|ref|XP_010323830.1| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type isoform X1 [Solanum lycopersicum] gi|68052031|sp|Q42883.1|ECAP_SOLLC RecName: Full=Calcium-transporting ATPase, endoplasmic reticulum-type gi|170378|gb|AAA34138.1| Ca2+-ATPase [Solanum lycopersicum] gi|4206311|gb|AAD11617.1| Ca2+-ATPase [Solanum lycopersicum] gi|4206313|gb|AAD11618.1| Ca2+-ATPase [Solanum lycopersicum] Length = 1048 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = -1 Query: 156 VNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 + EK F AWSW V+QCL+EY+VKL+KGLSTY+VDKRRE YG NEL+KEKGKP Sbjct: 1 MEEKPFPAWSWSVDQCLKEYQVKLEKGLSTYEVDKRRERYGLNELEKEKGKP 52 >gb|KHG03262.1| Calcium-transporting ATPase, endoplasmic reticulum-type [Gossypium arboreum] gi|728849106|gb|KHG28549.1| Calcium-transporting ATPase, endoplasmic reticulum-type [Gossypium arboreum] Length = 1050 Score = 88.6 bits (218), Expect = 2e-15 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = -1 Query: 156 VNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 + +K F AWSW VEQCL+EY VKLDKGLS+Y V+K+RE YGWNEL KEKGKP Sbjct: 1 MEKKPFPAWSWSVEQCLKEYNVKLDKGLSSYQVEKQREKYGWNELSKEKGKP 52 >emb|CBI40589.3| unnamed protein product [Vitis vinifera] Length = 778 Score = 88.2 bits (217), Expect = 2e-15 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = -1 Query: 156 VNEKSFKAWSWPVEQCLREYKVKLDKGLSTYDVDKRREIYGWNELQKEKGKP 1 + E F AWSW VEQCL+EY V++DKGLS+Y+V+KRRE YGWNEL KEKGKP Sbjct: 1 MEENPFPAWSWSVEQCLKEYNVRIDKGLSSYEVEKRRERYGWNELTKEKGKP 52