BLASTX nr result
ID: Forsythia21_contig00051552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00051552 (335 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007681012.1| hypothetical protein BAUCODRAFT_78881 [Baudo... 61 3e-07 >ref|XP_007681012.1| hypothetical protein BAUCODRAFT_78881 [Baudoinia compniacensis UAMH 10762] gi|449295876|gb|EMC91897.1| hypothetical protein BAUCODRAFT_78881 [Baudoinia compniacensis UAMH 10762] Length = 963 Score = 61.2 bits (147), Expect = 3e-07 Identities = 34/59 (57%), Positives = 39/59 (66%), Gaps = 5/59 (8%) Frame = +3 Query: 3 PQRQSINSQYKTIHEDIPEVPTRIVDHES-----VGDLGPEAVEEPVSSKFSHNTLPQR 164 PQR S+ S YK EDIPEVPTRI+ H+S VGD+GP EEPV +KFS N L R Sbjct: 893 PQRHSLQSHYKMHDEDIPEVPTRIIGHDSHAHEGVGDIGPVEPEEPV-TKFSPNGLEHR 950