BLASTX nr result
ID: Forsythia21_contig00051548
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00051548 (302 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ92886.1| hypothetical protein AUEXF2481DRAFT_31754 [Aureob... 64 4e-08 gb|EME41824.1| hypothetical protein DOTSEDRAFT_74025 [Dothistrom... 57 5e-06 gb|EKG20318.1| MIF4G-like type 3 [Macrophomina phaseolina MS6] 57 6e-06 >gb|KEQ92886.1| hypothetical protein AUEXF2481DRAFT_31754 [Aureobasidium subglaciale EXF-2481] Length = 1429 Score = 63.9 bits (154), Expect = 4e-08 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 3/64 (4%) Frame = +1 Query: 1 ESSGPSSRSGTPLNQKKDEPTTHANAFSALAALDGAME---PEQTAPSEAGSPPTAKAQP 171 E SGP+SR+GTP QKK+E TTH NAFSALAAL+ + E + PS AGSP +KA P Sbjct: 1360 EGSGPTSRAGTPSQQKKEE-TTHVNAFSALAALENQEDVGADEASPPSNAGSPSVSKAIP 1418 Query: 172 ASID 183 SID Sbjct: 1419 -SID 1421 >gb|EME41824.1| hypothetical protein DOTSEDRAFT_74025 [Dothistroma septosporum NZE10] Length = 1444 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/56 (53%), Positives = 39/56 (69%) Frame = +1 Query: 16 SSRSGTPLNQKKDEPTTHANAFSALAALDGAMEPEQTAPSEAGSPPTAKAQPASID 183 +SR+ TP KKDEP+T NAFSALAALD + E + P+ SPPTA+ +PA+ D Sbjct: 1387 TSRTNTPPVDKKDEPSTAQNAFSALAALDSSGEAPEETPA---SPPTARTEPAAHD 1439 >gb|EKG20318.1| MIF4G-like type 3 [Macrophomina phaseolina MS6] Length = 1520 Score = 56.6 bits (135), Expect = 6e-06 Identities = 31/59 (52%), Positives = 39/59 (66%) Frame = +1 Query: 1 ESSGPSSRSGTPLNQKKDEPTTHANAFSALAALDGAMEPEQTAPSEAGSPPTAKAQPAS 177 + SG SSR+GTP ++KD T H N+FSALAAL+G E +EA SP +K QPAS Sbjct: 1450 DDSGNSSRTGTPPVKEKDSSTHHVNSFSALAALEGGDE----GANEAASPEPSKVQPAS 1504