BLASTX nr result
ID: Forsythia21_contig00051427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00051427 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012851451.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_011098782.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_004233668.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_012081219.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_006338385.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 >ref|XP_012851451.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Erythranthe guttatus] Length = 675 Score = 72.0 bits (175), Expect = 1e-10 Identities = 36/56 (64%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = -3 Query: 171 MNGSSQSLSKTLKRLLPTTSAQCEPFLYHCA-TTKSLPTTKKLHAHVITLGLLSNH 7 MNG LS+TLK L TT+ QCE L+ CA TTKS TTKKLHAH IT GL+SNH Sbjct: 1 MNGQCPPLSRTLKNLFSTTAEQCESLLFRCATTTKSAATTKKLHAHAITSGLISNH 56 >ref|XP_011098782.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Sesamum indicum] Length = 641 Score = 70.9 bits (172), Expect = 3e-10 Identities = 38/57 (66%), Positives = 42/57 (73%), Gaps = 2/57 (3%) Frame = -3 Query: 171 MNGSS-QSLSKTLKRLLPTTSAQCEPFLYHCATT-KSLPTTKKLHAHVITLGLLSNH 7 MNG S LS TLK++ T+AQCE LY CATT KSL TTKKLHAH IT G+LSNH Sbjct: 1 MNGPSCPPLSHTLKQIFSATAAQCESLLYRCATTAKSLATTKKLHAHAITSGILSNH 57 >ref|XP_004233668.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Solanum lycopersicum] Length = 680 Score = 58.2 bits (139), Expect = 2e-06 Identities = 36/65 (55%), Positives = 41/65 (63%), Gaps = 8/65 (12%) Frame = -3 Query: 171 MNGSSQSLSKTL---KRLLPTTSA---QCEPFLYHCATTKSLPTTKKLHAHVITLGLLS- 13 MNG S LSK L KR++ TT+ QC+ L HCA KSL TTK +HAH ITLGLL Sbjct: 1 MNGPSLPLSKKLTHLKRVVETTATAAEQCKSLLEHCAKIKSLRTTKGVHAHTITLGLLQS 60 Query: 12 -NHTH 1 N TH Sbjct: 61 INSTH 65 >ref|XP_012081219.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Jatropha curcas] Length = 674 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = -3 Query: 171 MNGSSQSLSKTLKRLLPTTSAQCEPFLYHCATTKSLPTTKKLHAHVITLGLLSN 10 MNG SQ+LSKT K LL +T+ Q L H TKSL TK+LHAH IT GLLS+ Sbjct: 1 MNGPSQTLSKT-KHLLTSTTTQYMSLLEHYTATKSLTKTKQLHAHTITAGLLSS 53 >ref|XP_006338385.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39350-like [Solanum tuberosum] Length = 680 Score = 56.6 bits (135), Expect = 6e-06 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 6/60 (10%) Frame = -3 Query: 171 MNGSSQSLSKTL---KRLLPTTSA---QCEPFLYHCATTKSLPTTKKLHAHVITLGLLSN 10 MNG S LSK L KR++ TT+ QC+ L HCA KSL TTK +HAH ITLGLL + Sbjct: 1 MNGPSLPLSKKLTHLKRVVETTATAAEQCKSLLEHCAKIKSLRTTKGVHAHTITLGLLQS 60