BLASTX nr result
ID: Forsythia21_contig00051421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00051421 (316 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009602358.1| PREDICTED: probable cyclic nucleotide-gated ... 94 5e-17 ref|XP_009796589.1| PREDICTED: probable cyclic nucleotide-gated ... 91 3e-16 ref|XP_010251302.1| PREDICTED: putative cyclic nucleotide-gated ... 83 6e-14 ref|XP_006345037.1| PREDICTED: probable cyclic nucleotide-gated ... 83 6e-14 ref|XP_006345036.1| PREDICTED: probable cyclic nucleotide-gated ... 83 6e-14 ref|XP_007036173.1| Cyclic nucleotide-gated channel 16 [Theobrom... 82 2e-13 ref|XP_002511425.1| Cyclic nucleotide-gated ion channel, putativ... 81 2e-13 ref|XP_004236123.1| PREDICTED: probable cyclic nucleotide-gated ... 81 2e-13 ref|XP_012080094.1| PREDICTED: probable cyclic nucleotide-gated ... 80 5e-13 ref|XP_004232288.1| PREDICTED: putative cyclic nucleotide-gated ... 80 7e-13 ref|XP_010101189.1| putative cyclic nucleotide-gated ion channel... 79 2e-12 ref|XP_010663191.1| PREDICTED: putative cyclic nucleotide-gated ... 78 3e-12 emb|CBI15055.3| unnamed protein product [Vitis vinifera] 78 3e-12 emb|CAN67221.1| hypothetical protein VITISV_024547 [Vitis vinifera] 78 3e-12 ref|XP_012486291.1| PREDICTED: probable cyclic nucleotide-gated ... 77 4e-12 gb|KJB37012.1| hypothetical protein B456_006G187100 [Gossypium r... 77 4e-12 gb|KHG07052.1| hypothetical protein F383_05000 [Gossypium arboreum] 77 4e-12 ref|XP_006338546.1| PREDICTED: putative cyclic nucleotide-gated ... 77 4e-12 ref|XP_011009709.1| PREDICTED: probable cyclic nucleotide-gated ... 77 6e-12 ref|XP_002533179.1| Cyclic nucleotide-gated ion channel, putativ... 76 1e-11 >ref|XP_009602358.1| PREDICTED: probable cyclic nucleotide-gated ion channel 16 [Nicotiana tomentosiformis] Length = 682 Score = 93.6 bits (231), Expect = 5e-17 Identities = 41/63 (65%), Positives = 47/63 (74%) Frame = +3 Query: 120 YDNNKPWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAI 299 YD KPWW Q+LDPNGEFV +WN IFLFTS + LFVDPLF LP IR ETCM+TD L Sbjct: 18 YDRQKPWWQQILDPNGEFVARWNHIFLFTSFVGLFVDPLFLLLPIIR-ETCMSTDNVLGY 76 Query: 300 IVI 308 ++ Sbjct: 77 TIL 79 >ref|XP_009796589.1| PREDICTED: probable cyclic nucleotide-gated ion channel 16 [Nicotiana sylvestris] Length = 682 Score = 90.9 bits (224), Expect = 3e-16 Identities = 40/63 (63%), Positives = 46/63 (73%) Frame = +3 Query: 120 YDNNKPWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAI 299 YD KPWW Q+LDPNGEFV +WN IFL TS + LFVDPLF LP IR ETCM+TD L Sbjct: 18 YDRQKPWWQQILDPNGEFVARWNHIFLVTSFVGLFVDPLFLLLPIIR-ETCMSTDNVLGY 76 Query: 300 IVI 308 ++ Sbjct: 77 TIL 79 >ref|XP_010251302.1| PREDICTED: putative cyclic nucleotide-gated ion channel 18 [Nelumbo nucifera] Length = 693 Score = 83.2 bits (204), Expect = 6e-14 Identities = 33/61 (54%), Positives = 44/61 (72%) Frame = +3 Query: 123 DNNKPWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAII 302 D KPW Q+LDP GE VT+WN +FL + +IALF+DPL+FYLP+I C+ DF L ++ Sbjct: 24 DEQKPWQYQILDPGGELVTRWNHVFLVSCMIALFLDPLYFYLPSIGGPACLKMDFGLGVV 83 Query: 303 V 305 V Sbjct: 84 V 84 >ref|XP_006345037.1| PREDICTED: probable cyclic nucleotide-gated ion channel 16-like isoform X2 [Solanum tuberosum] Length = 492 Score = 83.2 bits (204), Expect = 6e-14 Identities = 38/64 (59%), Positives = 45/64 (70%) Frame = +3 Query: 120 YDNNKPWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAI 299 YD KP+W Q+ DPNGEFV +WN IFLFTS + LFVDPLF LP I +TCM TD L Sbjct: 17 YDQQKPFWKQIHDPNGEFVGRWNHIFLFTSFVGLFVDPLFLLLP-IIIDTCMGTDNLLGY 75 Query: 300 IVIL 311 +I+ Sbjct: 76 AIIV 79 >ref|XP_006345036.1| PREDICTED: probable cyclic nucleotide-gated ion channel 16-like isoform X1 [Solanum tuberosum] Length = 679 Score = 83.2 bits (204), Expect = 6e-14 Identities = 38/64 (59%), Positives = 45/64 (70%) Frame = +3 Query: 120 YDNNKPWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAI 299 YD KP+W Q+ DPNGEFV +WN IFLFTS + LFVDPLF LP I +TCM TD L Sbjct: 17 YDQQKPFWKQIHDPNGEFVGRWNHIFLFTSFVGLFVDPLFLLLP-IIIDTCMGTDNLLGY 75 Query: 300 IVIL 311 +I+ Sbjct: 76 AIIV 79 >ref|XP_007036173.1| Cyclic nucleotide-gated channel 16 [Theobroma cacao] gi|508773418|gb|EOY20674.1| Cyclic nucleotide-gated channel 16 [Theobroma cacao] Length = 694 Score = 81.6 bits (200), Expect = 2e-13 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = +3 Query: 135 PWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAIIV 305 PWW+Q+LDP + VTKWN I L T LIALF+DPL+FYLP I CM+ D L IIV Sbjct: 26 PWWDQILDPGSQIVTKWNYIILVTCLIALFLDPLYFYLPVIAGPACMSIDLGLGIIV 82 >ref|XP_002511425.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223550540|gb|EEF52027.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 680 Score = 81.3 bits (199), Expect = 2e-13 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = +3 Query: 138 WWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAIIV 305 WWNQ+LDP +FV KWN IFL T +IALF+DPL+FYLP I + CM+ D L I V Sbjct: 27 WWNQILDPGSDFVNKWNHIFLVTCMIALFLDPLYFYLPIIGGDACMDIDITLGIWV 82 >ref|XP_004236123.1| PREDICTED: probable cyclic nucleotide-gated ion channel 16 [Solanum lycopersicum] Length = 678 Score = 81.3 bits (199), Expect = 2e-13 Identities = 37/64 (57%), Positives = 44/64 (68%) Frame = +3 Query: 120 YDNNKPWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAI 299 YD KP+W Q+ DPNGEFV +WN IFLFTS + LFVDPLF LP I + CM TD L Sbjct: 17 YDQQKPFWKQIHDPNGEFVGRWNHIFLFTSFVGLFVDPLFLLLP-IIIDNCMGTDNLLGY 75 Query: 300 IVIL 311 +I+ Sbjct: 76 AIIV 79 >ref|XP_012080094.1| PREDICTED: probable cyclic nucleotide-gated ion channel 16 [Jatropha curcas] Length = 685 Score = 80.1 bits (196), Expect = 5e-13 Identities = 30/59 (50%), Positives = 43/59 (72%) Frame = +3 Query: 135 PWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAIIVIL 311 PWW Q+LDP +F+ +WN I LFT ++A+F+DP++FYLP I + CM+ DF L + V L Sbjct: 26 PWWYQILDPGSDFINRWNHIILFTFMVAMFLDPIYFYLPVIGGDACMDIDFPLGVWVTL 84 >ref|XP_004232288.1| PREDICTED: putative cyclic nucleotide-gated ion channel 18 [Solanum lycopersicum] Length = 690 Score = 79.7 bits (195), Expect = 7e-13 Identities = 29/55 (52%), Positives = 41/55 (74%) Frame = +3 Query: 120 YDNNKPWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTD 284 + N+ PWW Q+LDPN + V +WN +FL T LI+LF+DPL+FY+P + CM+TD Sbjct: 24 FSNDVPWWRQILDPNSDIVNRWNYVFLLTCLISLFIDPLYFYVPFVSDRACMSTD 78 >ref|XP_010101189.1| putative cyclic nucleotide-gated ion channel 16 [Morus notabilis] gi|587899464|gb|EXB87863.1| putative cyclic nucleotide-gated ion channel 16 [Morus notabilis] Length = 856 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/57 (57%), Positives = 39/57 (68%) Frame = +3 Query: 135 PWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAIIV 305 PWW Q+LDP +FV KWN IFL LIA+F+DPL+FYLP I CM D L I+V Sbjct: 29 PWWYQILDPGTDFVAKWNHIFLVACLIAMFLDPLYFYLPVIGGPACMEIDLGLGILV 85 >ref|XP_010663191.1| PREDICTED: putative cyclic nucleotide-gated ion channel 18 [Vitis vinifera] Length = 685 Score = 77.8 bits (190), Expect = 3e-12 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +3 Query: 132 KPWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAIIV 305 K WW Q+LDP G VT+WN IFL + L+ALF+DPL+FYLP I C D L I+V Sbjct: 13 KSWWTQILDPGGRLVTQWNHIFLISCLLALFLDPLYFYLPVIDGPACFRIDLGLGIVV 70 >emb|CBI15055.3| unnamed protein product [Vitis vinifera] Length = 637 Score = 77.8 bits (190), Expect = 3e-12 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +3 Query: 132 KPWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAIIV 305 K WW Q+LDP G VT+WN IFL + L+ALF+DPL+FYLP I C D L I+V Sbjct: 13 KSWWTQILDPGGRLVTQWNHIFLISCLLALFLDPLYFYLPVIDGPACFRIDLGLGIVV 70 >emb|CAN67221.1| hypothetical protein VITISV_024547 [Vitis vinifera] Length = 685 Score = 77.8 bits (190), Expect = 3e-12 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +3 Query: 132 KPWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAIIV 305 K WW Q+LDP G VT+WN IFL + L+ALF+DPL+FYLP I C D L I+V Sbjct: 13 KSWWTQILDPGGRLVTQWNHIFLISCLLALFLDPLYFYLPVIDGPACFRIDLGLGIVV 70 >ref|XP_012486291.1| PREDICTED: probable cyclic nucleotide-gated ion channel 16 [Gossypium raimondii] gi|823175973|ref|XP_012486292.1| PREDICTED: probable cyclic nucleotide-gated ion channel 16 [Gossypium raimondii] gi|763769798|gb|KJB37013.1| hypothetical protein B456_006G187100 [Gossypium raimondii] Length = 692 Score = 77.0 bits (188), Expect = 4e-12 Identities = 34/57 (59%), Positives = 39/57 (68%) Frame = +3 Query: 135 PWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAIIV 305 PWWNQVLDP +TKWN I L T L+ALF+DPL+F+LP I A CM D L I V Sbjct: 30 PWWNQVLDPGSPTLTKWNYIILCTCLVALFLDPLYFFLPVIGAPGCMQIDLGLGIFV 86 >gb|KJB37012.1| hypothetical protein B456_006G187100 [Gossypium raimondii] Length = 685 Score = 77.0 bits (188), Expect = 4e-12 Identities = 34/57 (59%), Positives = 39/57 (68%) Frame = +3 Query: 135 PWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAIIV 305 PWWNQVLDP +TKWN I L T L+ALF+DPL+F+LP I A CM D L I V Sbjct: 30 PWWNQVLDPGSPTLTKWNYIILCTCLVALFLDPLYFFLPVIGAPGCMQIDLGLGIFV 86 >gb|KHG07052.1| hypothetical protein F383_05000 [Gossypium arboreum] Length = 692 Score = 77.0 bits (188), Expect = 4e-12 Identities = 34/57 (59%), Positives = 39/57 (68%) Frame = +3 Query: 135 PWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAIIV 305 PWWNQVLDP +TKWN I L T L+ALF+DPL+F+LP I A CM D L I V Sbjct: 30 PWWNQVLDPGSPTLTKWNYIILCTCLVALFLDPLYFFLPVIGAPGCMQIDLGLGIFV 86 >ref|XP_006338546.1| PREDICTED: putative cyclic nucleotide-gated ion channel 18-like [Solanum tuberosum] Length = 690 Score = 77.0 bits (188), Expect = 4e-12 Identities = 28/50 (56%), Positives = 38/50 (76%) Frame = +3 Query: 135 PWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTD 284 PWW Q+LDPN + V +WN +FL T LI+LF+DPL+FY+P + CM+TD Sbjct: 29 PWWRQILDPNSDIVNRWNYVFLLTCLISLFIDPLYFYVPFVSERACMSTD 78 >ref|XP_011009709.1| PREDICTED: probable cyclic nucleotide-gated ion channel 16 [Populus euphratica] Length = 688 Score = 76.6 bits (187), Expect = 6e-12 Identities = 31/57 (54%), Positives = 40/57 (70%) Frame = +3 Query: 135 PWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNIRAETCMNTDFALAIIV 305 PWW+Q+ DP E V+KWN IFL +IA+F+DPL+FYLP I + CM D AL + V Sbjct: 26 PWWDQIHDPGSEIVSKWNHIFLVACMIAMFLDPLYFYLPIIGGDACMKIDIALGVWV 82 >ref|XP_002533179.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223527013|gb|EEF29202.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 396 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/62 (51%), Positives = 46/62 (74%), Gaps = 3/62 (4%) Frame = +3 Query: 126 NNKPWWNQVLDPNGEFVTKWNQIFLFTSLIALFVDPLFFYLPNI---RAETCMNTDFALA 296 +N PW +++LDP + V +WN+IFL + L+ALFVDPL+FYLP + A +C+NTDF L Sbjct: 71 DNPPWHHKILDPGSDIVLRWNRIFLVSCLLALFVDPLYFYLPTVGGNAASSCVNTDFKLR 130 Query: 297 II 302 I+ Sbjct: 131 IV 132