BLASTX nr result
ID: Forsythia21_contig00051396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00051396 (287 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012574893.1| PREDICTED: histone acetyltransferase HAC12-l... 56 8e-06 >ref|XP_012574893.1| PREDICTED: histone acetyltransferase HAC12-like [Cicer arietinum] Length = 1338 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/41 (58%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +2 Query: 2 KRIWYLLLLHSKNCRDSNCDMPRCMDIKKH-KTCAVESQSR 121 KRIW +L+ HSKNC+DS C++PRC D+KK+ K A++S+SR Sbjct: 1290 KRIWSILIAHSKNCKDSKCNIPRCRDLKKNVKLKAMQSKSR 1330