BLASTX nr result
ID: Forsythia21_contig00051223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00051223 (267 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY30832.1| putative extracellular exo-polygalacturonase [Dia... 59 2e-06 ref|XP_003835885.1| similar to extracellular exo-polygalacturona... 57 4e-06 gb|KKY14436.1| putative extracellular exo-polygalacturonase [Dip... 57 5e-06 ref|XP_007581139.1| putative extracellular exo-polygalacturonase... 56 8e-06 >gb|KKY30832.1| putative extracellular exo-polygalacturonase [Diaporthe ampelina] Length = 489 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -1 Query: 267 IRSINGSHQATCRNVDNALLDLDCTEWSKGYNPA 166 IR+INGS+ TCRN+D LLDL+C +WSKGYNPA Sbjct: 456 IRTINGSNLVTCRNLDRTLLDLNCDDWSKGYNPA 489 >ref|XP_003835885.1| similar to extracellular exo-polygalacturonase [Leptosphaeria maculans JN3] gi|312212437|emb|CBX92520.1| similar to extracellular exo-polygalacturonase [Leptosphaeria maculans JN3] Length = 443 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -1 Query: 267 IRSINGSHQATCRNVDNALLDLDCTEWSKGYNPA 166 IR+INGS TCRNVD LL+++C++WSKGYNPA Sbjct: 410 IRTINGSSLVTCRNVDKGLLEVECSDWSKGYNPA 443 >gb|KKY14436.1| putative extracellular exo-polygalacturonase [Diplodia seriata] Length = 686 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -1 Query: 267 IRSINGSHQATCRNVDNALLDLDCTEWSKGYNPA 166 IR+INGS+ TCRN+D LLD++C +WSKGYNPA Sbjct: 653 IRTINGSNLVTCRNMDEDLLDVNCVDWSKGYNPA 686 >ref|XP_007581139.1| putative extracellular exo-polygalacturonase protein [Neofusicoccum parvum UCRNP2] gi|485927308|gb|EOD51379.1| putative extracellular exo-polygalacturonase protein [Neofusicoccum parvum UCRNP2] Length = 420 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -1 Query: 267 IRSINGSHQATCRNVDNALLDLDCTEWSKGYNPA 166 IRSINGS+ TCRN+D LD++C +WSKGYNPA Sbjct: 387 IRSINGSNLVTCRNLDRNTLDVNCVDWSKGYNPA 420