BLASTX nr result
ID: Forsythia21_contig00051089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00051089 (237 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080434.1| PREDICTED: uncharacterized protein LOC105163... 58 2e-06 >ref|XP_011080434.1| PREDICTED: uncharacterized protein LOC105163690 [Sesamum indicum] Length = 478 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -2 Query: 236 LCKTQLILCMVLYFVFIAFSNQYHNCPSSNFFSSFWKTA 120 LC+T LI+C+V YF FI SNQY NCP+S+FFS F K A Sbjct: 14 LCRTLLIICLVFYFAFIYLSNQYPNCPASDFFSPFLKRA 52