BLASTX nr result
ID: Forsythia21_contig00051049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00051049 (258 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101049.1| PREDICTED: uncharacterized protein DDB_G0287... 68 3e-09 ref|XP_011101051.1| PREDICTED: filaggrin-like [Sesamum indicum] 62 2e-07 ref|XP_009765819.1| PREDICTED: zinc finger CCCH domain-containin... 60 8e-07 ref|XP_009765817.1| PREDICTED: zinc finger CCCH domain-containin... 60 8e-07 ref|XP_009586923.1| PREDICTED: uncharacterized protein LOC104084... 60 8e-07 ref|XP_009586922.1| PREDICTED: uncharacterized protein LOC104084... 60 8e-07 ref|XP_009586921.1| PREDICTED: uncharacterized protein LOC104084... 60 8e-07 ref|XP_012854219.1| PREDICTED: zinc finger CCCH domain-containin... 58 2e-06 gb|EYU23343.1| hypothetical protein MIMGU_mgv11b000466mg [Erythr... 58 2e-06 ref|XP_010659288.1| PREDICTED: uncharacterized protein LOC100265... 58 3e-06 ref|XP_009757278.1| PREDICTED: zinc finger CCCH domain-containin... 57 6e-06 ref|XP_009757276.1| PREDICTED: zinc finger CCCH domain-containin... 57 6e-06 ref|XP_009757275.1| PREDICTED: zinc finger CCCH domain-containin... 57 6e-06 ref|XP_009619003.1| PREDICTED: zinc finger CCCH domain-containin... 57 6e-06 ref|XP_009619002.1| PREDICTED: trichohyalin-like isoform X2 [Nic... 57 6e-06 ref|XP_009619001.1| PREDICTED: uncharacterized protein LOC104111... 57 6e-06 >ref|XP_011101049.1| PREDICTED: uncharacterized protein DDB_G0287625-like [Sesamum indicum] Length = 1302 Score = 67.8 bits (164), Expect = 3e-09 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = -1 Query: 258 KEVPIDSAGNVQEPKLVSTKCGTLLNSD-ASSEACKGIMPESNESELVNLSRIHNSPEST 82 K ++S N E K V T+CG L+NSD SSEAC+ +MPES S +NLSRIH+SPEST Sbjct: 1242 KVAQMESGSNNDELKFVDTRCGALVNSDDVSSEACEAMMPESIVSGSLNLSRIHHSPEST 1301 Query: 81 H 79 H Sbjct: 1302 H 1302 >ref|XP_011101051.1| PREDICTED: filaggrin-like [Sesamum indicum] Length = 1304 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -1 Query: 246 IDSAGNVQEPKLVSTKCGTLLNSD-ASSEACKGIMPESNESELVNLSRIHNSPESTH 79 ++S N E K V +C L+NSD S EAC+ +MPES S VNLSRIH+SPESTH Sbjct: 1248 MESGSNNDELKFVDARCSALVNSDDVSLEACEAMMPESIVSGSVNLSRIHHSPESTH 1304 >ref|XP_009765819.1| PREDICTED: zinc finger CCCH domain-containing protein 13-like isoform X3 [Nicotiana sylvestris] Length = 1281 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -1 Query: 225 QEPKLVSTKCGTLLNSDASSEACKGIMPESNESELVNLSRIHNSPESTH 79 +E + V KCG L + D SSE + +MPES ES VNLSRIH+SPESTH Sbjct: 1233 EEEESVDAKCGPLRHPDVSSEVFEAVMPESIESGSVNLSRIHHSPESTH 1281 >ref|XP_009765817.1| PREDICTED: zinc finger CCCH domain-containing protein 13-like isoform X1 [Nicotiana sylvestris] gi|698540631|ref|XP_009765818.1| PREDICTED: zinc finger CCCH domain-containing protein 13-like isoform X2 [Nicotiana sylvestris] Length = 1286 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -1 Query: 225 QEPKLVSTKCGTLLNSDASSEACKGIMPESNESELVNLSRIHNSPESTH 79 +E + V KCG L + D SSE + +MPES ES VNLSRIH+SPESTH Sbjct: 1238 EEEESVDAKCGPLRHPDVSSEVFEAVMPESIESGSVNLSRIHHSPESTH 1286 >ref|XP_009586923.1| PREDICTED: uncharacterized protein LOC104084703 isoform X3 [Nicotiana tomentosiformis] Length = 1296 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -1 Query: 225 QEPKLVSTKCGTLLNSDASSEACKGIMPESNESELVNLSRIHNSPESTH 79 +E + V KCG L + D SSE + +MPES ES VNLSRIH+SPESTH Sbjct: 1248 EEEESVDAKCGPLRHPDVSSEVFEAVMPESIESGSVNLSRIHHSPESTH 1296 >ref|XP_009586922.1| PREDICTED: uncharacterized protein LOC104084703 isoform X2 [Nicotiana tomentosiformis] Length = 1300 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -1 Query: 225 QEPKLVSTKCGTLLNSDASSEACKGIMPESNESELVNLSRIHNSPESTH 79 +E + V KCG L + D SSE + +MPES ES VNLSRIH+SPESTH Sbjct: 1252 EEEESVDAKCGPLRHPDVSSEVFEAVMPESIESGSVNLSRIHHSPESTH 1300 >ref|XP_009586921.1| PREDICTED: uncharacterized protein LOC104084703 isoform X1 [Nicotiana tomentosiformis] Length = 1301 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -1 Query: 225 QEPKLVSTKCGTLLNSDASSEACKGIMPESNESELVNLSRIHNSPESTH 79 +E + V KCG L + D SSE + +MPES ES VNLSRIH+SPESTH Sbjct: 1253 EEEESVDAKCGPLRHPDVSSEVFEAVMPESIESGSVNLSRIHHSPESTH 1301 >ref|XP_012854219.1| PREDICTED: zinc finger CCCH domain-containing protein 13 [Erythranthe guttatus] Length = 1266 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/52 (61%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -1 Query: 231 NVQEPKLVSTKCGTLLNSD-ASSEACKGIMPESNESELVNLSRIHNSPESTH 79 N +E KLV +K G LL+SD SSEA + +MPES + VNLSRIH+SPESTH Sbjct: 1215 NNEETKLVDSKFGPLLSSDDVSSEASEAMMPESMVAGSVNLSRIHHSPESTH 1266 >gb|EYU23343.1| hypothetical protein MIMGU_mgv11b000466mg [Erythranthe guttata] Length = 1061 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/52 (61%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -1 Query: 231 NVQEPKLVSTKCGTLLNSD-ASSEACKGIMPESNESELVNLSRIHNSPESTH 79 N +E KLV +K G LL+SD SSEA + +MPES + VNLSRIH+SPESTH Sbjct: 1010 NNEETKLVDSKFGPLLSSDDVSSEASEAMMPESMVAGSVNLSRIHHSPESTH 1061 >ref|XP_010659288.1| PREDICTED: uncharacterized protein LOC100265054 [Vitis vinifera] Length = 1178 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = -1 Query: 222 EPKLVSTKCGTLLNSDASSEACKGIMPESNESELVNLSRIHNSPESTH 79 + KLV TK L SD SE C+ +MPE ES VNLSRIH+SPESTH Sbjct: 1131 DKKLVDTKSDPLFFSDRPSEGCESVMPELIESGSVNLSRIHHSPESTH 1178 >ref|XP_009757278.1| PREDICTED: zinc finger CCCH domain-containing protein 13-like isoform X3 [Nicotiana sylvestris] Length = 1179 Score = 56.6 bits (135), Expect = 6e-06 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 5/60 (8%) Frame = -1 Query: 243 DSAGNV-----QEPKLVSTKCGTLLNSDASSEACKGIMPESNESELVNLSRIHNSPESTH 79 DS GN +E ++V KC LL SSEA + +MPES E VNLSRIH+SPESTH Sbjct: 1120 DSVGNFSDDFKKEKEIVDVKCDPLLLPCVSSEAFEAVMPESIEFGSVNLSRIHHSPESTH 1179 >ref|XP_009757276.1| PREDICTED: zinc finger CCCH domain-containing protein 13-like isoform X2 [Nicotiana sylvestris] Length = 1225 Score = 56.6 bits (135), Expect = 6e-06 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 5/60 (8%) Frame = -1 Query: 243 DSAGNV-----QEPKLVSTKCGTLLNSDASSEACKGIMPESNESELVNLSRIHNSPESTH 79 DS GN +E ++V KC LL SSEA + +MPES E VNLSRIH+SPESTH Sbjct: 1166 DSVGNFSDDFKKEKEIVDVKCDPLLLPCVSSEAFEAVMPESIEFGSVNLSRIHHSPESTH 1225 >ref|XP_009757275.1| PREDICTED: zinc finger CCCH domain-containing protein 13-like isoform X1 [Nicotiana sylvestris] Length = 1230 Score = 56.6 bits (135), Expect = 6e-06 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 5/60 (8%) Frame = -1 Query: 243 DSAGNV-----QEPKLVSTKCGTLLNSDASSEACKGIMPESNESELVNLSRIHNSPESTH 79 DS GN +E ++V KC LL SSEA + +MPES E VNLSRIH+SPESTH Sbjct: 1171 DSVGNFSDDFKKEKEIVDVKCDPLLLPCVSSEAFEAVMPESIEFGSVNLSRIHHSPESTH 1230 >ref|XP_009619003.1| PREDICTED: zinc finger CCCH domain-containing protein 13-like isoform X3 [Nicotiana tomentosiformis] Length = 1179 Score = 56.6 bits (135), Expect = 6e-06 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 5/60 (8%) Frame = -1 Query: 243 DSAGNV-----QEPKLVSTKCGTLLNSDASSEACKGIMPESNESELVNLSRIHNSPESTH 79 DS GN +E ++V KC LL SSEA + +MPES E VNLSRIH+SPESTH Sbjct: 1120 DSVGNFSDDFKKEKEIVDVKCDPLLLPYVSSEAFEAVMPESIEFGSVNLSRIHHSPESTH 1179 >ref|XP_009619002.1| PREDICTED: trichohyalin-like isoform X2 [Nicotiana tomentosiformis] Length = 1225 Score = 56.6 bits (135), Expect = 6e-06 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 5/60 (8%) Frame = -1 Query: 243 DSAGNV-----QEPKLVSTKCGTLLNSDASSEACKGIMPESNESELVNLSRIHNSPESTH 79 DS GN +E ++V KC LL SSEA + +MPES E VNLSRIH+SPESTH Sbjct: 1166 DSVGNFSDDFKKEKEIVDVKCDPLLLPYVSSEAFEAVMPESIEFGSVNLSRIHHSPESTH 1225 >ref|XP_009619001.1| PREDICTED: uncharacterized protein LOC104111100 isoform X1 [Nicotiana tomentosiformis] Length = 1230 Score = 56.6 bits (135), Expect = 6e-06 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 5/60 (8%) Frame = -1 Query: 243 DSAGNV-----QEPKLVSTKCGTLLNSDASSEACKGIMPESNESELVNLSRIHNSPESTH 79 DS GN +E ++V KC LL SSEA + +MPES E VNLSRIH+SPESTH Sbjct: 1171 DSVGNFSDDFKKEKEIVDVKCDPLLLPYVSSEAFEAVMPESIEFGSVNLSRIHHSPESTH 1230