BLASTX nr result
ID: Forsythia21_contig00050848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00050848 (259 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ76058.1| gag protein [Cucumis melo] 57 4e-06 >emb|CAJ76058.1| gag protein [Cucumis melo] Length = 122 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -3 Query: 137 KKDCLEVIDERPVEITDNSKCKKMNNSAIVNLHMGLADEVLSSIE 3 K +CLE ID+RP EITD++K +M+ +A+ N+H+ L D VLSSIE Sbjct: 4 KDNCLEAIDKRPAEITDDNKWNEMDGNAMANIHLALVDNVLSSIE 48