BLASTX nr result
ID: Forsythia21_contig00050728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00050728 (240 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003850105.1| ATP-binding cassette family ATPase [Zymosept... 61 3e-07 ref|XP_001398253.1| ABC transporter ATP-binding protein ARB1 [As... 61 3e-07 ref|XP_001274028.1| ABC transporter, putative [Aspergillus clava... 61 3e-07 gb|KIV84072.1| ABC transporter ATP-binding protein ARB1 [Exophia... 60 4e-07 gb|EMF11636.1| ABC_tran-domain-containing protein [Sphaerulina m... 60 4e-07 gb|KJK64193.1| ABC transporter [Aspergillus parasiticus SU-1] 60 6e-07 gb|KIV97816.1| ABC transporter ATP-binding protein ARB1 [Exophia... 60 6e-07 ref|XP_007781898.1| ABC transporter ATP-binding protein ARB1 [Co... 60 6e-07 ref|XP_007927072.1| ABC transporter, ABC-F family, GCN-EF3 type ... 60 6e-07 ref|XP_001823147.1| ABC transporter ATP-binding protein ARB1 [As... 60 6e-07 ref|XP_007586862.1| putative atp-binding cassette sub-family f m... 60 7e-07 gb|EME43553.1| hypothetical protein DOTSEDRAFT_174448 [Dothistro... 60 7e-07 dbj|GAA92911.1| ABC transporter [Aspergillus kawachii IFO 4308] 60 7e-07 gb|KKY14407.1| putative atp-binding cassette sub-family f member... 59 1e-06 ref|XP_010758067.1| ABC transporter ATP-binding protein ARB1 [Pa... 59 1e-06 ref|XP_003017131.1| hypothetical protein ARB_04007 [Arthroderma ... 59 1e-06 ref|XP_007675197.1| hypothetical protein BAUCODRAFT_32879 [Baudo... 59 1e-06 gb|EKG15832.1| ABC transporter-like protein [Macrophomina phaseo... 59 1e-06 gb|EGE04028.1| ATP-binding cassette sub-family F member 2 [Trich... 59 1e-06 gb|EGD92511.1| ATP-binding cassette sub-family F member 2 [Trich... 59 1e-06 >ref|XP_003850105.1| ATP-binding cassette family ATPase [Zymoseptoria tritici IPO323] gi|339469983|gb|EGP85081.1| ABC transporter domain-containing protein [Zymoseptoria tritici IPO323] gi|796704348|gb|KJX96307.1| atp-binding cassette sub-family f member 2 like protein [Zymoseptoria brevis] Length = 627 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTVTRWDGSIGEYK +L+KKM+ Sbjct: 592 AKDIMVCENKTVTRWDGSIGEYKGHLRKKML 622 >ref|XP_001398253.1| ABC transporter ATP-binding protein ARB1 [Aspergillus niger CBS 513.88] gi|134083819|emb|CAK47152.1| unnamed protein product [Aspergillus niger] gi|350633941|gb|EHA22305.1| ABC transporter [Aspergillus niger ATCC 1015] Length = 613 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKT+TRWDG+IGEYK +L+KKMI Sbjct: 578 AKDIMVCENKTITRWDGTIGEYKNHLRKKMI 608 >ref|XP_001274028.1| ABC transporter, putative [Aspergillus clavatus NRRL 1] gi|119402181|gb|EAW12602.1| ABC transporter, putative [Aspergillus clavatus NRRL 1] Length = 618 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDI+VCENKTVTRWDGSIGEYK +L+KKM+ Sbjct: 583 AKDILVCENKTVTRWDGSIGEYKNHLRKKMV 613 >gb|KIV84072.1| ABC transporter ATP-binding protein ARB1 [Exophiala sideris] Length = 633 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTVTRW+GSIGEYK +L+KKM+ Sbjct: 598 AKDIMVCENKTVTRWNGSIGEYKNHLRKKMV 628 >gb|EMF11636.1| ABC_tran-domain-containing protein [Sphaerulina musiva SO2202] Length = 627 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTVTRWDGSIG YK +L+KKMI Sbjct: 592 AKDIMVCENKTVTRWDGSIGAYKNHLRKKMI 622 >gb|KJK64193.1| ABC transporter [Aspergillus parasiticus SU-1] Length = 618 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTVTRWDG+IG+YK +L+KKMI Sbjct: 583 AKDIMVCENKTVTRWDGTIGQYKDHLRKKMI 613 >gb|KIV97816.1| ABC transporter ATP-binding protein ARB1 [Exophiala mesophila] Length = 628 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTV RWDGSIGEYK +L+KKM+ Sbjct: 593 AKDIMVCENKTVRRWDGSIGEYKNHLRKKMV 623 >ref|XP_007781898.1| ABC transporter ATP-binding protein ARB1 [Coniosporium apollinis CBS 100218] gi|494830012|gb|EON66581.1| ABC transporter ATP-binding protein ARB1 [Coniosporium apollinis CBS 100218] Length = 629 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTV RWDGSIGEYK +L+KKM+ Sbjct: 594 AKDIMVCENKTVRRWDGSIGEYKNHLRKKMV 624 >ref|XP_007927072.1| ABC transporter, ABC-F family, GCN-EF3 type [Pseudocercospora fijiensis CIRAD86] gi|452982771|gb|EME82530.1| ABC transporter, ABC-F family, GCN-EF3 type [Pseudocercospora fijiensis CIRAD86] Length = 632 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKM 149 AKDIMVCENKTVTRWDGSIG+YK +L+KKM Sbjct: 597 AKDIMVCENKTVTRWDGSIGQYKNHLRKKM 626 >ref|XP_001823147.1| ABC transporter ATP-binding protein ARB1 [Aspergillus oryzae RIB40] gi|238494494|ref|XP_002378483.1| ribosome biogenesis ABC transporter Arb1, putative [Aspergillus flavus NRRL3357] gi|83771884|dbj|BAE62014.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220695133|gb|EED51476.1| ribosome biogenesis ABC transporter Arb1, putative [Aspergillus flavus NRRL3357] gi|391871300|gb|EIT80460.1| putative transporter [Aspergillus oryzae 3.042] gi|635508748|gb|KDE80723.1| putative transporter [Aspergillus oryzae 100-8] gi|768702078|gb|KJJ29184.1| ABC transporter [Aspergillus flavus AF70] Length = 617 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTVTRWDG+IG+YK +L+KKMI Sbjct: 582 AKDIMVCENKTVTRWDGTIGQYKDHLRKKMI 612 >ref|XP_007586862.1| putative atp-binding cassette sub-family f member 2 protein [Neofusicoccum parvum UCRNP2] gi|485919294|gb|EOD45668.1| putative atp-binding cassette sub-family f member 2 protein [Neofusicoccum parvum UCRNP2] Length = 609 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTV RWDGSIGEYK +L+KKM+ Sbjct: 574 AKDIMVCENKTVRRWDGSIGEYKNHLRKKML 604 >gb|EME43553.1| hypothetical protein DOTSEDRAFT_174448 [Dothistroma septosporum NZE10] Length = 631 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKM 149 AKDIMVCENKTVTRWDG+IGEYKK L+ KM Sbjct: 596 AKDIMVCENKTVTRWDGTIGEYKKKLRNKM 625 >dbj|GAA92911.1| ABC transporter [Aspergillus kawachii IFO 4308] Length = 614 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTVTRW+G+IGEYK +L+KKMI Sbjct: 579 AKDIMVCENKTVTRWNGTIGEYKNHLRKKMI 609 >gb|KKY14407.1| putative atp-binding cassette sub-family f member 2 [Phaeomoniella chlamydospora] Length = 628 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTV RWDGSIGEYK L+KKMI Sbjct: 593 AKDIMVCENKTVRRWDGSIGEYKNYLRKKMI 623 >ref|XP_010758067.1| ABC transporter ATP-binding protein ARB1 [Paracoccidioides brasiliensis Pb18] gi|699751123|gb|EEH46542.2| ABC transporter ATP-binding protein ARB1 [Paracoccidioides brasiliensis Pb18] gi|719934989|gb|EEH17676.2| ABC transporter ATP-binding protein ARB1 [Paracoccidioides brasiliensis Pb03] Length = 627 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTV RWDGSIGEYK +L+KKM+ Sbjct: 592 AKDIMVCENKTVRRWDGSIGEYKAHLRKKML 622 >ref|XP_003017131.1| hypothetical protein ARB_04007 [Arthroderma benhamiae CBS 112371] gi|302664781|ref|XP_003024016.1| hypothetical protein TRV_01783 [Trichophyton verrucosum HKI 0517] gi|291180702|gb|EFE36486.1| hypothetical protein ARB_04007 [Arthroderma benhamiae CBS 112371] gi|291188043|gb|EFE43398.1| hypothetical protein TRV_01783 [Trichophyton verrucosum HKI 0517] Length = 622 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTV RWDG+IGEYK +L+KKMI Sbjct: 587 AKDIMVCENKTVRRWDGTIGEYKNHLRKKMI 617 >ref|XP_007675197.1| hypothetical protein BAUCODRAFT_32879 [Baudoinia compniacensis UAMH 10762] gi|449301126|gb|EMC97137.1| hypothetical protein BAUCODRAFT_32879 [Baudoinia compniacensis UAMH 10762] Length = 632 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVC+NKTVTRWDGSIGEYK L+KKM+ Sbjct: 597 AKDIMVCQNKTVTRWDGSIGEYKNFLRKKML 627 >gb|EKG15832.1| ABC transporter-like protein [Macrophomina phaseolina MS6] Length = 609 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTV RWDG+IGEYK +L+KKMI Sbjct: 574 AKDIMVCENKTVRRWDGTIGEYKNHLRKKMI 604 >gb|EGE04028.1| ATP-binding cassette sub-family F member 2 [Trichophyton equinum CBS 127.97] gi|607888276|gb|EZF29210.1| ABC transporter ATP-binding protein ARB1 [Trichophyton interdigitale H6] gi|633043631|gb|KDB20935.1| ABC transporter ATP-binding protein ARB1 [Trichophyton interdigitale MR816] Length = 622 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTV RWDG+IGEYK +L+KKMI Sbjct: 587 AKDIMVCENKTVRRWDGTIGEYKNHLRKKMI 617 >gb|EGD92511.1| ATP-binding cassette sub-family F member 2 [Trichophyton tonsurans CBS 112818] Length = 595 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 238 AKDIMVCENKTVTRWDGSIGEYKKNLQKKMI 146 AKDIMVCENKTV RWDG+IGEYK +L+KKMI Sbjct: 560 AKDIMVCENKTVRRWDGTIGEYKNHLRKKMI 590