BLASTX nr result
ID: Forsythia21_contig00050580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00050580 (393 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072082.1| PREDICTED: CDT1-like protein a, chloroplasti... 70 5e-10 ref|XP_012855600.1| PREDICTED: CDT1-like protein a, chloroplasti... 69 2e-09 ref|XP_009627074.1| PREDICTED: CDT1-like protein a, chloroplasti... 59 1e-06 ref|XP_009627071.1| PREDICTED: CDT1-like protein a, chloroplasti... 59 1e-06 ref|XP_009627069.1| PREDICTED: CDT1-like protein a, chloroplasti... 59 1e-06 ref|XP_006351544.1| PREDICTED: CDT1-like protein a, chloroplasti... 58 3e-06 ref|XP_006351543.1| PREDICTED: CDT1-like protein a, chloroplasti... 58 3e-06 ref|XP_002267629.3| PREDICTED: CDT1-like protein a, chloroplasti... 57 5e-06 ref|XP_009792289.1| PREDICTED: CDT1-like protein a, chloroplasti... 57 5e-06 ref|XP_009792288.1| PREDICTED: CDT1-like protein a, chloroplasti... 57 5e-06 ref|XP_009792287.1| PREDICTED: CDT1-like protein a, chloroplasti... 57 5e-06 emb|CBI26412.3| unnamed protein product [Vitis vinifera] 57 5e-06 ref|XP_010317553.1| PREDICTED: CDT1-like protein a, chloroplasti... 56 8e-06 ref|XP_010317552.1| PREDICTED: CDT1-like protein a, chloroplasti... 56 8e-06 ref|XP_010317551.1| PREDICTED: CDT1-like protein a, chloroplasti... 56 8e-06 >ref|XP_011072082.1| PREDICTED: CDT1-like protein a, chloroplastic [Sesamum indicum] Length = 443 Score = 70.1 bits (170), Expect = 5e-10 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERIDIV 278 E+LVPDWF K+ AP GDLLYNVKKVSD+NS+CERID++ Sbjct: 406 ERLVPDWFCKRLAPSGDLLYNVKKVSDVNSICERIDVI 443 >ref|XP_012855600.1| PREDICTED: CDT1-like protein a, chloroplastic [Erythranthe guttatus] gi|604302749|gb|EYU22306.1| hypothetical protein MIMGU_mgv1a006725mg [Erythranthe guttata] Length = 433 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERID 284 EKLVPDW YKK P GDLLYNVKKVSD+NS+CER+D Sbjct: 396 EKLVPDWIYKKVEPSGDLLYNVKKVSDVNSICERVD 431 >ref|XP_009627074.1| PREDICTED: CDT1-like protein a, chloroplastic isoform X3 [Nicotiana tomentosiformis] Length = 527 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERI 287 E+LVPDW KK AP GDLLY++KKV DL+SVCERI Sbjct: 490 ERLVPDWLCKKSAPTGDLLYSIKKVPDLSSVCERI 524 >ref|XP_009627071.1| PREDICTED: CDT1-like protein a, chloroplastic isoform X2 [Nicotiana tomentosiformis] Length = 528 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERI 287 E+LVPDW KK AP GDLLY++KKV DL+SVCERI Sbjct: 491 ERLVPDWLCKKSAPTGDLLYSIKKVPDLSSVCERI 525 >ref|XP_009627069.1| PREDICTED: CDT1-like protein a, chloroplastic isoform X1 [Nicotiana tomentosiformis] gi|697145862|ref|XP_009627070.1| PREDICTED: CDT1-like protein a, chloroplastic isoform X1 [Nicotiana tomentosiformis] Length = 529 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERI 287 E+LVPDW KK AP GDLLY++KKV DL+SVCERI Sbjct: 492 ERLVPDWLCKKSAPTGDLLYSIKKVPDLSSVCERI 526 >ref|XP_006351544.1| PREDICTED: CDT1-like protein a, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 515 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERI 287 E+LVPDW KK AP GDL+Y++K SDLNSVCER+ Sbjct: 478 ERLVPDWLCKKSAPTGDLVYSIKNASDLNSVCERV 512 >ref|XP_006351543.1| PREDICTED: CDT1-like protein a, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 516 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERI 287 E+LVPDW KK AP GDL+Y++K SDLNSVCER+ Sbjct: 479 ERLVPDWLCKKSAPTGDLVYSIKNASDLNSVCERV 513 >ref|XP_002267629.3| PREDICTED: CDT1-like protein a, chloroplastic [Vitis vinifera] gi|731422212|ref|XP_010662036.1| PREDICTED: CDT1-like protein a, chloroplastic [Vitis vinifera] gi|731422214|ref|XP_010662037.1| PREDICTED: CDT1-like protein a, chloroplastic [Vitis vinifera] Length = 549 Score = 57.0 bits (136), Expect = 5e-06 Identities = 21/35 (60%), Positives = 31/35 (88%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERI 287 EKL+P+W ++K APCGDLLY+++K S+L+SVC R+ Sbjct: 502 EKLIPEWIFRKLAPCGDLLYSIRKESNLDSVCARL 536 >ref|XP_009792289.1| PREDICTED: CDT1-like protein a, chloroplastic isoform X3 [Nicotiana sylvestris] Length = 527 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERI 287 E+LVP+W KK AP GDLLY++KKV DL+SVCER+ Sbjct: 490 ERLVPEWLCKKSAPTGDLLYSIKKVPDLSSVCERV 524 >ref|XP_009792288.1| PREDICTED: CDT1-like protein a, chloroplastic isoform X2 [Nicotiana sylvestris] Length = 528 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERI 287 E+LVP+W KK AP GDLLY++KKV DL+SVCER+ Sbjct: 491 ERLVPEWLCKKSAPTGDLLYSIKKVPDLSSVCERV 525 >ref|XP_009792287.1| PREDICTED: CDT1-like protein a, chloroplastic isoform X1 [Nicotiana sylvestris] Length = 529 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERI 287 E+LVP+W KK AP GDLLY++KKV DL+SVCER+ Sbjct: 492 ERLVPEWLCKKSAPTGDLLYSIKKVPDLSSVCERV 526 >emb|CBI26412.3| unnamed protein product [Vitis vinifera] Length = 458 Score = 57.0 bits (136), Expect = 5e-06 Identities = 21/35 (60%), Positives = 31/35 (88%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERI 287 EKL+P+W ++K APCGDLLY+++K S+L+SVC R+ Sbjct: 411 EKLIPEWIFRKLAPCGDLLYSIRKESNLDSVCARL 445 >ref|XP_010317553.1| PREDICTED: CDT1-like protein a, chloroplastic isoform X3 [Solanum lycopersicum] Length = 512 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERI 287 E+LVPDW K+ A GDLLY++KK SDLNSVCER+ Sbjct: 475 ERLVPDWLSKESASTGDLLYSIKKASDLNSVCERV 509 >ref|XP_010317552.1| PREDICTED: CDT1-like protein a, chloroplastic isoform X2 [Solanum lycopersicum] Length = 513 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERI 287 E+LVPDW K+ A GDLLY++KK SDLNSVCER+ Sbjct: 476 ERLVPDWLSKESASTGDLLYSIKKASDLNSVCERV 510 >ref|XP_010317551.1| PREDICTED: CDT1-like protein a, chloroplastic isoform X1 [Solanum lycopersicum] Length = 514 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 391 EKLVPDWFYKKFAPCGDLLYNVKKVSDLNSVCERI 287 E+LVPDW K+ A GDLLY++KK SDLNSVCER+ Sbjct: 477 ERLVPDWLSKESASTGDLLYSIKKASDLNSVCERV 511