BLASTX nr result
ID: Forsythia21_contig00049781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00049781 (367 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME38465.1| hypothetical protein DOTSEDRAFT_57543 [Dothistrom... 57 4e-06 >gb|EME38465.1| hypothetical protein DOTSEDRAFT_57543 [Dothistroma septosporum NZE10] Length = 337 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -2 Query: 114 MSNQAAYLDGKDKTFRVDSAEVPKPKENEVIVKNHAIA 1 MSNQAA+LDGKD+ RVD A+ PKP +V++KNHAIA Sbjct: 1 MSNQAAWLDGKDQKLRVDKADFPKPDPEQVVIKNHAIA 38