BLASTX nr result
ID: Forsythia21_contig00049669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00049669 (282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJX93946.1| mitochondrial phosphate carrier protein 2 [Zymose... 68 3e-09 ref|XP_003853985.1| hypothetical protein MYCGRDRAFT_70216 [Zymos... 68 3e-09 ref|XP_003840932.1| similar to mitochondrial phosphate carrier p... 67 4e-09 gb|KEQ84823.1| mitochondrial carrier [Aureobasidium pullulans EX... 66 8e-09 ref|XP_003298322.1| hypothetical protein PTT_08990 [Pyrenophora ... 66 8e-09 ref|XP_001939732.1| mitochondrial phosphate carrier protein [Pyr... 66 8e-09 ref|XP_007692250.1| hypothetical protein COCMIDRAFT_106688 [Bipo... 65 1e-08 gb|EME45318.1| hypothetical protein DOTSEDRAFT_71146 [Dothistrom... 65 1e-08 ref|XP_007700461.1| hypothetical protein COCSADRAFT_37597 [Bipol... 65 1e-08 ref|XP_007716582.1| hypothetical protein COCCADRAFT_107365 [Bipo... 65 2e-08 ref|XP_008028986.1| hypothetical protein SETTUDRAFT_164656 [Seto... 65 2e-08 gb|EMD93043.1| hypothetical protein COCHEDRAFT_1193378 [Bipolari... 65 2e-08 ref|XP_007589533.1| putative mitochondrial phosphate carrier pro... 64 4e-08 gb|EKG11100.1| Mitochondrial substrate/solute carrier [Macrophom... 64 5e-08 gb|EMF13574.1| mitochondrial phosphate carrier protein [Sphaerul... 63 7e-08 ref|XP_007674272.1| hypothetical protein BAUCODRAFT_401797 [Baud... 62 1e-07 gb|KEQ92312.1| hypothetical protein AUEXF2481DRAFT_43094 [Aureob... 62 2e-07 gb|KEQ76002.1| mitochondrial carrier [Aureobasidium namibiae CBS... 62 2e-07 ref|XP_001588988.1| hypothetical protein SS1G_09621 [Sclerotinia... 61 3e-07 ref|XP_001558710.1| mitochondrial phosphate carrier protein [Bot... 60 4e-07 >gb|KJX93946.1| mitochondrial phosphate carrier protein 2 [Zymoseptoria brevis] Length = 308 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 110 SALPKPQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 + LP PQKKIELFSG YF ACTIGG+IACGPTH+AV Sbjct: 5 TGLPTPQKKIELFSGTYFGACTIGGVIACGPTHSAV 40 >ref|XP_003853985.1| hypothetical protein MYCGRDRAFT_70216 [Zymoseptoria tritici IPO323] gi|339473868|gb|EGP88961.1| hypothetical protein MYCGRDRAFT_70216 [Zymoseptoria tritici IPO323] Length = 308 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 110 SALPKPQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 + LP PQKKIELFSG YF ACTIGG+IACGPTH+AV Sbjct: 5 TGLPTPQKKIELFSGTYFGACTIGGVIACGPTHSAV 40 >ref|XP_003840932.1| similar to mitochondrial phosphate carrier protein [Leptosphaeria maculans JN3] gi|312217505|emb|CBX97453.1| similar to mitochondrial phosphate carrier protein [Leptosphaeria maculans JN3] Length = 304 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 98 KPQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 KPQKKIEL+SGNYFAACT+GG+IACGPTHT V Sbjct: 5 KPQKKIELYSGNYFAACTVGGVIACGPTHTMV 36 >gb|KEQ84823.1| mitochondrial carrier [Aureobasidium pullulans EXF-150] Length = 312 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 95 PQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 PQKKIELFSG YFAACT+GGIIACGPTHTAV Sbjct: 14 PQKKIELFSGTYFAACTLGGIIACGPTHTAV 44 >ref|XP_003298322.1| hypothetical protein PTT_08990 [Pyrenophora teres f. teres 0-1] gi|311328556|gb|EFQ93588.1| hypothetical protein PTT_08990 [Pyrenophora teres f. teres 0-1] Length = 308 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 98 KPQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 KPQKKIELFSG+YFAACT+GGIIACGPTHT V Sbjct: 9 KPQKKIELFSGSYFAACTMGGIIACGPTHTMV 40 >ref|XP_001939732.1| mitochondrial phosphate carrier protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187975825|gb|EDU42451.1| mitochondrial phosphate carrier protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 308 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 98 KPQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 KPQKKIELFSG+YFAACT+GGIIACGPTHT V Sbjct: 9 KPQKKIELFSGSYFAACTMGGIIACGPTHTMV 40 >ref|XP_007692250.1| hypothetical protein COCMIDRAFT_106688 [Bipolaris oryzae ATCC 44560] gi|576927549|gb|EUC41230.1| hypothetical protein COCMIDRAFT_106688 [Bipolaris oryzae ATCC 44560] Length = 308 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 98 KPQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 KPQ+KIELFSG+YFAACT+GGIIACGPTHT V Sbjct: 9 KPQRKIELFSGSYFAACTLGGIIACGPTHTMV 40 >gb|EME45318.1| hypothetical protein DOTSEDRAFT_71146 [Dothistroma septosporum NZE10] Length = 311 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -2 Query: 113 TSALPKPQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 +SA P KKIELFSG YF ACTIGGIIACGPTHTAV Sbjct: 7 SSATPDAAKKIELFSGTYFGACTIGGIIACGPTHTAV 43 >ref|XP_007700461.1| hypothetical protein COCSADRAFT_37597 [Bipolaris sorokiniana ND90Pr] gi|451850545|gb|EMD63847.1| hypothetical protein COCSADRAFT_37597 [Bipolaris sorokiniana ND90Pr] Length = 308 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 98 KPQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 KPQ+KIELFSG+YFAACT+GGIIACGPTHT V Sbjct: 9 KPQRKIELFSGSYFAACTLGGIIACGPTHTMV 40 >ref|XP_007716582.1| hypothetical protein COCCADRAFT_107365 [Bipolaris zeicola 26-R-13] gi|576914786|gb|EUC29120.1| hypothetical protein COCCADRAFT_107365 [Bipolaris zeicola 26-R-13] gi|578485008|gb|EUN22515.1| hypothetical protein COCVIDRAFT_19770 [Bipolaris victoriae FI3] Length = 308 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 98 KPQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 KPQ+KIELFSG+YFAACT+GG+IACGPTHT V Sbjct: 9 KPQRKIELFSGSYFAACTLGGVIACGPTHTMV 40 >ref|XP_008028986.1| hypothetical protein SETTUDRAFT_164656 [Setosphaeria turcica Et28A] gi|482806130|gb|EOA83203.1| hypothetical protein SETTUDRAFT_164656 [Setosphaeria turcica Et28A] Length = 308 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 98 KPQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 KPQ+KIELFSG+YFAACT+GGIIACGPTHT V Sbjct: 9 KPQRKIELFSGSYFAACTMGGIIACGPTHTMV 40 >gb|EMD93043.1| hypothetical protein COCHEDRAFT_1193378 [Bipolaris maydis C5] gi|477587487|gb|ENI04568.1| hypothetical protein COCC4DRAFT_169749 [Bipolaris maydis ATCC 48331] Length = 308 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 98 KPQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 KPQ+KIELFSG+YFAACT+GG+IACGPTHT V Sbjct: 9 KPQRKIELFSGSYFAACTLGGVIACGPTHTMV 40 >ref|XP_007589533.1| putative mitochondrial phosphate carrier protein [Neofusicoccum parvum UCRNP2] gi|485915306|gb|EOD42994.1| putative mitochondrial phosphate carrier protein [Neofusicoccum parvum UCRNP2] Length = 264 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 92 QKKIELFSGNYFAACTIGGIIACGPTHTAV 3 QKKIELFSG YFAACTIGG+IACGPTHTAV Sbjct: 12 QKKIELFSGTYFAACTIGGVIACGPTHTAV 41 >gb|EKG11100.1| Mitochondrial substrate/solute carrier [Macrophomina phaseolina MS6] Length = 309 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 119 TMTSALPKPQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 T A QKKIELFSG YFAACT+GG+IACGPTHTAV Sbjct: 3 TKGDARAAAQKKIELFSGTYFAACTLGGVIACGPTHTAV 41 >gb|EMF13574.1| mitochondrial phosphate carrier protein [Sphaerulina musiva SO2202] Length = 314 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 95 PQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 P++KIELFSG YFAACT+GGIIACGPTHTAV Sbjct: 16 PKEKIELFSGTYFAACTLGGIIACGPTHTAV 46 >ref|XP_007674272.1| hypothetical protein BAUCODRAFT_401797 [Baudoinia compniacensis UAMH 10762] gi|449303381|gb|EMC99389.1| hypothetical protein BAUCODRAFT_401797 [Baudoinia compniacensis UAMH 10762] Length = 317 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 95 PQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 PQKKIELFS YF ACT+GGIIACGPTHTAV Sbjct: 19 PQKKIELFSATYFGACTLGGIIACGPTHTAV 49 >gb|KEQ92312.1| hypothetical protein AUEXF2481DRAFT_43094 [Aureobasidium subglaciale EXF-2481] Length = 312 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 95 PQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 P++ IELFSG YFAACT+GGIIACGPTHTAV Sbjct: 14 PKRSIELFSGTYFAACTLGGIIACGPTHTAV 44 >gb|KEQ76002.1| mitochondrial carrier [Aureobasidium namibiae CBS 147.97] Length = 312 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 95 PQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 P++ IELFSG YFAACT+GGIIACGPTHTAV Sbjct: 14 PKRNIELFSGTYFAACTLGGIIACGPTHTAV 44 >ref|XP_001588988.1| hypothetical protein SS1G_09621 [Sclerotinia sclerotiorum 1980] gi|154694016|gb|EDN93754.1| hypothetical protein SS1G_09621 [Sclerotinia sclerotiorum 1980 UF-70] Length = 307 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 119 TMTSALPKPQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 ++ +ALP+P KIEL+SG YFAAC +GGIIACGPTHTAV Sbjct: 3 SLENALPQP--KIELYSGKYFAACGLGGIIACGPTHTAV 39 >ref|XP_001558710.1| mitochondrial phosphate carrier protein [Botrytis cinerea B05.10] gi|347830566|emb|CCD46263.1| similar to mitochondrial phosphate carrier protein [Botrytis cinerea T4] gi|472243303|gb|EMR87960.1| putative mitochondrial phosphate carrier protein [Botrytis cinerea BcDW1] Length = 307 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -2 Query: 119 TMTSALPKPQKKIELFSGNYFAACTIGGIIACGPTHTAV 3 ++ ALP+P KIEL+SG YFAAC +GGIIACGPTHTAV Sbjct: 3 SLEKALPQP--KIELYSGKYFAACGLGGIIACGPTHTAV 39