BLASTX nr result
ID: Forsythia21_contig00048744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00048744 (252 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006377971.1| hypothetical protein POPTR_0011s16830g [Popu... 41 2e-06 ref|XP_007146670.1| hypothetical protein PHAVU_006G059600g [Phas... 44 2e-06 ref|XP_011000329.1| PREDICTED: protein YLS9-like [Populus euphra... 40 4e-06 ref|XP_008353212.1| PREDICTED: uncharacterized protein LOC103416... 40 7e-06 ref|XP_007205724.1| hypothetical protein PRUPE_ppa010048mg [Prun... 39 9e-06 ref|XP_008218871.1| PREDICTED: uncharacterized protein LOC103319... 39 9e-06 ref|XP_002300576.2| hypothetical protein POPTR_0001s47240g [Popu... 39 9e-06 >ref|XP_006377971.1| hypothetical protein POPTR_0011s16830g [Populus trichocarpa] gi|550328577|gb|ERP55768.1| hypothetical protein POPTR_0011s16830g [Populus trichocarpa] Length = 256 Score = 40.8 bits (94), Expect(2) = 2e-06 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -2 Query: 194 NPTFDIPRASLNFVYFDSPELINSN 120 NP FDIP A+LN VYFDSPE N + Sbjct: 106 NPVFDIPNANLNSVYFDSPEYFNGD 130 Score = 37.0 bits (84), Expect(2) = 2e-06 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = -3 Query: 118 PNSNLDVRFEYLDLELYF*QSYIIYQPKQP 29 PN +DVRFEY+D+ELYF I Q QP Sbjct: 140 PNRKIDVRFEYVDIELYFSDRLIGTQALQP 169 >ref|XP_007146670.1| hypothetical protein PHAVU_006G059600g [Phaseolus vulgaris] gi|561019893|gb|ESW18664.1| hypothetical protein PHAVU_006G059600g [Phaseolus vulgaris] Length = 252 Score = 43.5 bits (101), Expect(2) = 2e-06 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 194 NPTFDIPRASLNFVYFDSPELINSN 120 NPTFDIP A+LN VYFDSPE +N + Sbjct: 102 NPTFDIPNANLNSVYFDSPEYLNGD 126 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = -3 Query: 127 IPTPNSNLDVRFEYLDLELYF*QSYIIYQPKQP 29 I PN +DVRFE LD+EL+F I Q QP Sbjct: 133 ITNPNRKIDVRFESLDVELFFSDRIISTQSIQP 165 >ref|XP_011000329.1| PREDICTED: protein YLS9-like [Populus euphratica] Length = 256 Score = 40.4 bits (93), Expect(2) = 4e-06 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -2 Query: 194 NPTFDIPRASLNFVYFDSPELINSN 120 NP FDIP A+LN +YFDSPE N + Sbjct: 106 NPVFDIPNANLNSIYFDSPEYFNGD 130 Score = 36.6 bits (83), Expect(2) = 4e-06 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = -3 Query: 118 PNSNLDVRFEYLDLELYF*QSYIIYQPKQP 29 PN +DVRFEY D+ELYF I Q QP Sbjct: 140 PNQKIDVRFEYADIELYFSDRLIGTQALQP 169 >ref|XP_008353212.1| PREDICTED: uncharacterized protein LOC103416763 [Malus domestica] Length = 264 Score = 39.7 bits (91), Expect(2) = 7e-06 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -2 Query: 191 PTFDIPRASLNFVYFDSPELINSN 120 P+FDIP ASLN +YFDSPE N + Sbjct: 115 PSFDIPNASLNTIYFDSPEYFNGD 138 Score = 36.6 bits (83), Expect(2) = 7e-06 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = -3 Query: 118 PNSNLDVRFEYLDLELYF*QSYIIYQPKQP 29 PN +D+RFEYLD+ELYF I Q P Sbjct: 148 PNRKIDIRFEYLDMELYFSDRLIATQSLAP 177 >ref|XP_007205724.1| hypothetical protein PRUPE_ppa010048mg [Prunus persica] gi|462401366|gb|EMJ06923.1| hypothetical protein PRUPE_ppa010048mg [Prunus persica] Length = 266 Score = 38.9 bits (89), Expect(2) = 9e-06 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 191 PTFDIPRASLNFVYFDSPELINSN 120 P FDIP ASLN +YFDSPE N + Sbjct: 117 PLFDIPNASLNTIYFDSPEYFNGD 140 Score = 37.0 bits (84), Expect(2) = 9e-06 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = -3 Query: 118 PNSNLDVRFEYLDLELYF*QSYIIYQPKQP 29 PN +D+RFEYLDLELYF I Q P Sbjct: 150 PNRKIDIRFEYLDLELYFSDRLIATQSLGP 179 >ref|XP_008218871.1| PREDICTED: uncharacterized protein LOC103319140 [Prunus mume] Length = 264 Score = 38.9 bits (89), Expect(2) = 9e-06 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 191 PTFDIPRASLNFVYFDSPELINSN 120 P FDIP ASLN +YFDSPE N + Sbjct: 115 PLFDIPNASLNTIYFDSPEYFNGD 138 Score = 37.0 bits (84), Expect(2) = 9e-06 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = -3 Query: 118 PNSNLDVRFEYLDLELYF*QSYIIYQPKQP 29 PN +D+RFEYLDLELYF I Q P Sbjct: 148 PNRKIDIRFEYLDLELYFSDRLIATQSLGP 177 >ref|XP_002300576.2| hypothetical protein POPTR_0001s47240g [Populus trichocarpa] gi|550350074|gb|EEE85381.2| hypothetical protein POPTR_0001s47240g [Populus trichocarpa] Length = 239 Score = 38.5 bits (88), Expect(2) = 9e-06 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -2 Query: 194 NPTFDIPRASLNFVYFDSPELINSN 120 NP FDIP A+L+ +YFDSPE N + Sbjct: 89 NPVFDIPNANLSSIYFDSPEYFNGD 113 Score = 37.4 bits (85), Expect(2) = 9e-06 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = -3 Query: 118 PNSNLDVRFEYLDLELYF*QSYIIYQPKQP 29 PN +DVRFEY+D+ELYF I Q QP Sbjct: 123 PNQKIDVRFEYVDIELYFSDRLIGTQALQP 152