BLASTX nr result
ID: Forsythia21_contig00048625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00048625 (523 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082011.1| PREDICTED: histone-lysine N-methyltransferas... 59 1e-06 emb|CDP00009.1| unnamed protein product [Coffea canephora] 56 8e-06 >ref|XP_011082011.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Sesamum indicum] Length = 468 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -2 Query: 516 PRVFGKGALRRRLAQDLLTGELRALKSASAWLKIYCVTL 400 P + GK LRR+LAQDLLTGELR LKSASAWL+ YC TL Sbjct: 427 PYLCGKSFLRRQLAQDLLTGELRVLKSASAWLENYCSTL 465 >emb|CDP00009.1| unnamed protein product [Coffea canephora] Length = 533 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 501 KGALRRRLAQDLLTGELRALKSASAWLKIYCVTL 400 K ALRR++A DLLTGELR LKSASAWLK YC TL Sbjct: 497 KHALRRQMAHDLLTGELRVLKSASAWLKKYCATL 530