BLASTX nr result
ID: Forsythia21_contig00048577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00048577 (355 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU24411.1| unknown [Glycine max] 69 9e-10 ref|XP_003637074.1| Cell wall-associated hydrolase, partial [Med... 65 2e-08 ref|XP_010112784.1| Metal transporter Nramp5 [Morus notabilis] g... 63 7e-08 >gb|ACU24411.1| unknown [Glycine max] Length = 64 Score = 69.3 bits (168), Expect = 9e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 354 HSFGKSLSPVHLRRKSAQSISYYALFQG*LLLGKPP 247 HSFG+SLSPVHLRRKSA+S+SYYALFQG LLLGKPP Sbjct: 9 HSFGRSLSPVHLRRKSARSVSYYALFQGWLLLGKPP 44 >ref|XP_003637074.1| Cell wall-associated hydrolase, partial [Medicago truncatula] Length = 733 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -2 Query: 354 HSFGKSLSPVHLRRKSAQSISYYALFQG*LLLGKPP 247 HSFG+SLSPVHL+RK A+S+SYYALF+G LLLGKPP Sbjct: 372 HSFGRSLSPVHLQRKGARSVSYYALFKGWLLLGKPP 407 >ref|XP_010112784.1| Metal transporter Nramp5 [Morus notabilis] gi|587948646|gb|EXC34899.1| Metal transporter Nramp5 [Morus notabilis] Length = 337 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 354 HSFGKSLSPVHLRRKSAQSISYYALFQG*LLLGKPP 247 HSFG+SLSPVHLRRKSA+S+SYYALFQG LLL K P Sbjct: 206 HSFGRSLSPVHLRRKSARSVSYYALFQGWLLLEKSP 241