BLASTX nr result
ID: Forsythia21_contig00047854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00047854 (282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB33933.1| hypothetical protein B456_006G039200 [Gossypium r... 58 6e-07 ref|XP_012445496.1| PREDICTED: lysine histidine transporter 1-li... 54 3e-06 >gb|KJB33933.1| hypothetical protein B456_006G039200 [Gossypium raimondii] Length = 480 Score = 57.8 bits (138), Expect(2) = 6e-07 Identities = 27/50 (54%), Positives = 36/50 (72%) Frame = +3 Query: 15 LPCVMYLAIYKPKKISLSWFTNWVCEANTFF*EFSTLLGLLCMSNGSVFS 164 LPC+M+LAIYKP+K SLSW+TNWVC+ + + +T L C SN +FS Sbjct: 395 LPCIMWLAIYKPRKFSLSWWTNWVCKLDF---DSTTTSLLRCASNWFLFS 441 Score = 21.9 bits (45), Expect(2) = 6e-07 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 218 LRNITLQANDYYSYS 262 LR I LQA DY YS Sbjct: 466 LRQIILQAKDYEFYS 480 >ref|XP_012445496.1| PREDICTED: lysine histidine transporter 1-like isoform X1 [Gossypium raimondii] gi|763744127|gb|KJB11626.1| hypothetical protein B456_001G268700 [Gossypium raimondii] Length = 454 Score = 54.3 bits (129), Expect(2) = 3e-06 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = +3 Query: 15 LPCVMYLAIYKPKKISLSWFTNWVCEANTFF*EFSTLLGLLCMS 146 LPC+M+LAIYKPKK SLSW TNW+C +LGLL M+ Sbjct: 400 LPCIMWLAIYKPKKFSLSWCTNWIC----------IILGLLLMT 433 Score = 23.1 bits (48), Expect(2) = 3e-06 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 218 LRNITLQANDYYSYS 262 LRNI + A DY+ YS Sbjct: 440 LRNIIINAKDYHFYS 454