BLASTX nr result
ID: Forsythia21_contig00047833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00047833 (366 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008223803.1| PREDICTED: pentatricopeptide repeat-containi... 121 2e-25 ref|XP_007214631.1| hypothetical protein PRUPE_ppa002950mg [Prun... 120 5e-25 ref|XP_002266689.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 ref|XP_012066813.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_012444898.1| PREDICTED: pentatricopeptide repeat-containi... 113 4e-23 ref|XP_008367262.1| PREDICTED: pentatricopeptide repeat-containi... 113 6e-23 ref|XP_009345233.1| PREDICTED: pentatricopeptide repeat-containi... 112 1e-22 ref|XP_010261548.1| PREDICTED: pentatricopeptide repeat-containi... 109 6e-22 ref|XP_007014357.1| Pentatricopeptide repeat superfamily protein... 108 1e-21 ref|XP_007014360.1| Pentatricopeptide repeat superfamily protein... 108 2e-21 ref|XP_011042994.1| PREDICTED: pentatricopeptide repeat-containi... 107 3e-21 ref|XP_011081745.1| PREDICTED: pentatricopeptide repeat-containi... 107 4e-21 ref|XP_002532091.1| pentatricopeptide repeat-containing protein,... 106 5e-21 ref|XP_002318172.1| pentatricopeptide repeat-containing family p... 106 5e-21 gb|KDO61856.1| hypothetical protein CISIN_1g042098mg [Citrus sin... 105 9e-21 ref|XP_006474640.1| PREDICTED: pentatricopeptide repeat-containi... 105 9e-21 ref|XP_006453289.1| hypothetical protein CICLE_v10010788mg, part... 105 9e-21 ref|XP_010091060.1| hypothetical protein L484_000436 [Morus nota... 105 1e-20 ref|XP_011462354.1| PREDICTED: pentatricopeptide repeat-containi... 104 3e-20 ref|XP_004242849.1| PREDICTED: pentatricopeptide repeat-containi... 104 3e-20 >ref|XP_008223803.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Prunus mume] Length = 620 Score = 121 bits (303), Expect = 2e-25 Identities = 59/113 (52%), Positives = 81/113 (71%), Gaps = 4/113 (3%) Frame = -3 Query: 328 VLRTKIFINQFSNHITIKIVARKYHDHHHP----TLIDQILFLLRKCKSTQTVRQIHSQM 161 +LR K+ + + IT + + + HH+P +L ++L+LL++C ST+ V+QIH+QM Sbjct: 1 MLRAKVSSHLITRQITFEKSHTQLNPHHNPNQSPSLSRKLLYLLKQCVSTKEVKQIHTQM 60 Query: 160 LINSIHKPNFLLSKLILLKDFEYSTFFFSQIPNVNDYAFNIMIRGLTTTWQKF 2 LINSIHKPNFLL K+I KDF Y++ FS IP NDYAFN+MIRGLTTTW K+ Sbjct: 61 LINSIHKPNFLLPKIIDHKDFSYASMLFSHIPEPNDYAFNVMIRGLTTTWHKY 113 >ref|XP_007214631.1| hypothetical protein PRUPE_ppa002950mg [Prunus persica] gi|462410496|gb|EMJ15830.1| hypothetical protein PRUPE_ppa002950mg [Prunus persica] Length = 619 Score = 120 bits (300), Expect = 5e-25 Identities = 62/116 (53%), Positives = 80/116 (68%), Gaps = 7/116 (6%) Frame = -3 Query: 328 VLRTKIFINQFSNHITIKIVARKYHDH-------HHPTLIDQILFLLRKCKSTQTVRQIH 170 +LR K+ S+ IT +I K H H P+L ++L+LL+ C ST+ ++QIH Sbjct: 1 MLRAKVS----SHLITRQITFEKSHTHLNPHNPNQSPSLSQKLLYLLKHCVSTKELKQIH 56 Query: 169 SQMLINSIHKPNFLLSKLILLKDFEYSTFFFSQIPNVNDYAFNIMIRGLTTTWQKF 2 +QMLINSIHKPNFLL K++ LKDF Y++ FS IP NDYAFNIMIRGLTTTW K+ Sbjct: 57 TQMLINSIHKPNFLLPKIVDLKDFSYASMLFSHIPEPNDYAFNIMIRGLTTTWHKY 112 >ref|XP_002266689.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Vitis vinifera] gi|296090299|emb|CBI40118.3| unnamed protein product [Vitis vinifera] Length = 618 Score = 117 bits (294), Expect = 2e-24 Identities = 59/109 (54%), Positives = 78/109 (71%) Frame = -3 Query: 328 VLRTKIFINQFSNHITIKIVARKYHDHHHPTLIDQILFLLRKCKSTQTVRQIHSQMLINS 149 +L+ K + S H T + K H TL D++L LL++C ST++++QIH+QM+IN+ Sbjct: 1 MLKPKASSHLISRHFTKALA--KSQRHAQQTLTDKLLSLLKQCTSTKSLQQIHTQMIINA 58 Query: 148 IHKPNFLLSKLILLKDFEYSTFFFSQIPNVNDYAFNIMIRGLTTTWQKF 2 IHKPNFLL + I LKDF ++ FSQIP N+YAFNIMIRGLTTTWQKF Sbjct: 59 IHKPNFLLHRFIDLKDFNNASLLFSQIPYPNEYAFNIMIRGLTTTWQKF 107 >ref|XP_012066813.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Jatropha curcas] gi|802538086|ref|XP_012066819.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Jatropha curcas] gi|802538090|ref|XP_012066826.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Jatropha curcas] gi|643741089|gb|KDP46635.1| hypothetical protein JCGZ_04569 [Jatropha curcas] Length = 614 Score = 115 bits (287), Expect = 1e-23 Identities = 54/79 (68%), Positives = 67/79 (84%) Frame = -3 Query: 238 TLIDQILFLLRKCKSTQTVRQIHSQMLINSIHKPNFLLSKLILLKDFEYSTFFFSQIPNV 59 T +++L LL+ C ST+ ++QIH+QMLINSI KPNFLLSK+I LKDF Y++ FFSQIPN Sbjct: 29 TPTEKLLNLLKLCLSTKPLQQIHTQMLINSIQKPNFLLSKIIALKDFTYASLFFSQIPNP 88 Query: 58 NDYAFNIMIRGLTTTWQKF 2 NDYAFNIMIRGLT TW+K+ Sbjct: 89 NDYAFNIMIRGLTATWRKY 107 >ref|XP_012444898.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Gossypium raimondii] gi|763786747|gb|KJB53743.1| hypothetical protein B456_009G003200 [Gossypium raimondii] gi|763786748|gb|KJB53744.1| hypothetical protein B456_009G003200 [Gossypium raimondii] gi|763786749|gb|KJB53745.1| hypothetical protein B456_009G003200 [Gossypium raimondii] gi|763786750|gb|KJB53746.1| hypothetical protein B456_009G003200 [Gossypium raimondii] gi|763786751|gb|KJB53747.1| hypothetical protein B456_009G003200 [Gossypium raimondii] gi|763786752|gb|KJB53748.1| hypothetical protein B456_009G003200 [Gossypium raimondii] gi|763786753|gb|KJB53749.1| hypothetical protein B456_009G003200 [Gossypium raimondii] Length = 613 Score = 113 bits (283), Expect = 4e-23 Identities = 50/83 (60%), Positives = 67/83 (80%) Frame = -3 Query: 250 HHHPTLIDQILFLLRKCKSTQTVRQIHSQMLINSIHKPNFLLSKLILLKDFEYSTFFFSQ 71 H H + +++L LL+KC ST+ ++QIH+QML+N+I KPNFLLSK+I LK+F Y++ FSQ Sbjct: 22 HFHQSFAEKLLSLLKKCTSTKLLQQIHTQMLVNAIQKPNFLLSKIIDLKNFAYASLLFSQ 81 Query: 70 IPNVNDYAFNIMIRGLTTTWQKF 2 IP NDYAFN+MIRGLTT WQ + Sbjct: 82 IPQPNDYAFNVMIRGLTTAWQNY 104 >ref|XP_008367262.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400-like [Malus domestica] Length = 619 Score = 113 bits (282), Expect = 6e-23 Identities = 51/80 (63%), Positives = 65/80 (81%) Frame = -3 Query: 241 PTLIDQILFLLRKCKSTQTVRQIHSQMLINSIHKPNFLLSKLILLKDFEYSTFFFSQIPN 62 P L + IL LL++C ST+ ++QIH+QMLINS+ KPNFLL ++I LKDF Y++ FS IP Sbjct: 33 PPLFENILHLLKQCASTKQLKQIHTQMLINSVDKPNFLLPRIIDLKDFTYASLLFSHIPE 92 Query: 61 VNDYAFNIMIRGLTTTWQKF 2 NDYAFN+MIRGLTTTWQK+ Sbjct: 93 PNDYAFNVMIRGLTTTWQKY 112 >ref|XP_009345233.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Pyrus x bretschneideri] Length = 619 Score = 112 bits (280), Expect = 1e-22 Identities = 50/80 (62%), Positives = 65/80 (81%) Frame = -3 Query: 241 PTLIDQILFLLRKCKSTQTVRQIHSQMLINSIHKPNFLLSKLILLKDFEYSTFFFSQIPN 62 P L + +L LL++C ST+ ++QIH+QMLINS+ KPNFLL ++I LKDF Y++ FS IP Sbjct: 33 PPLFENLLHLLKQCASTKQLKQIHTQMLINSVDKPNFLLPRIIDLKDFTYASLLFSHIPE 92 Query: 61 VNDYAFNIMIRGLTTTWQKF 2 NDYAFN+MIRGLTTTWQK+ Sbjct: 93 PNDYAFNVMIRGLTTTWQKY 112 >ref|XP_010261548.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Nelumbo nucifera] Length = 619 Score = 109 bits (273), Expect = 6e-22 Identities = 55/112 (49%), Positives = 80/112 (71%), Gaps = 2/112 (1%) Frame = -3 Query: 331 VVLRTKIFINQFSNHITIKIVARKYHDHHHP--TLIDQILFLLRKCKSTQTVRQIHSQML 158 +V+++K + FS +T + + + +HP +L D++L LL++ S ++++QIHSQML Sbjct: 1 MVIKSKPMLYPFSRSLTFE---KSHLSPYHPQESLADKLLTLLKQSDSPESLKQIHSQML 57 Query: 157 INSIHKPNFLLSKLILLKDFEYSTFFFSQIPNVNDYAFNIMIRGLTTTWQKF 2 INSI NFLL KL+ LKDFEY++ FSQIP ND++FN+MIRGLT TW KF Sbjct: 58 INSIQLDNFLLPKLVDLKDFEYASLLFSQIPEPNDFSFNVMIRGLTNTWHKF 109 >ref|XP_007014357.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784720|gb|EOY31976.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 656 Score = 108 bits (270), Expect = 1e-21 Identities = 56/113 (49%), Positives = 76/113 (67%) Frame = -3 Query: 340 SSMVVLRTKIFINQFSNHITIKIVARKYHDHHHPTLIDQILFLLRKCKSTQTVRQIHSQM 161 S +L+TK + S I I + + H + +++L L+KC S + ++QIH+QM Sbjct: 34 SRHTMLKTKASTDLVSLPIII-LSKTQLHKFRQRSFTEKLLSFLKKCTSIKLLQQIHAQM 92 Query: 160 LINSIHKPNFLLSKLILLKDFEYSTFFFSQIPNVNDYAFNIMIRGLTTTWQKF 2 LINSI KPNFLLSK+I L +F Y++ FSQIP NDYAFN+MIRGLTTTWQ + Sbjct: 93 LINSIQKPNFLLSKIIDLNNFAYASLLFSQIPQPNDYAFNVMIRGLTTTWQHY 145 >ref|XP_007014360.1| Pentatricopeptide repeat superfamily protein isoform 4 [Theobroma cacao] gi|590581496|ref|XP_007014363.1| Pentatricopeptide repeat superfamily protein isoform 4 [Theobroma cacao] gi|508784723|gb|EOY31979.1| Pentatricopeptide repeat superfamily protein isoform 4 [Theobroma cacao] gi|508784726|gb|EOY31982.1| Pentatricopeptide repeat superfamily protein isoform 4 [Theobroma cacao] Length = 619 Score = 108 bits (269), Expect = 2e-21 Identities = 55/109 (50%), Positives = 75/109 (68%) Frame = -3 Query: 328 VLRTKIFINQFSNHITIKIVARKYHDHHHPTLIDQILFLLRKCKSTQTVRQIHSQMLINS 149 +L+TK + S I I + + H + +++L L+KC S + ++QIH+QMLINS Sbjct: 1 MLKTKASTDLVSLPIII-LSKTQLHKFRQRSFTEKLLSFLKKCTSIKLLQQIHAQMLINS 59 Query: 148 IHKPNFLLSKLILLKDFEYSTFFFSQIPNVNDYAFNIMIRGLTTTWQKF 2 I KPNFLLSK+I L +F Y++ FSQIP NDYAFN+MIRGLTTTWQ + Sbjct: 60 IQKPNFLLSKIIDLNNFAYASLLFSQIPQPNDYAFNVMIRGLTTTWQHY 108 >ref|XP_011042994.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Populus euphratica] Length = 617 Score = 107 bits (267), Expect = 3e-21 Identities = 51/111 (45%), Positives = 77/111 (69%) Frame = -3 Query: 334 MVVLRTKIFINQFSNHITIKIVARKYHDHHHPTLIDQILFLLRKCKSTQTVRQIHSQMLI 155 M+ R F++ + H+ + + + HH TL +++L L+++CKS ++QIH+QMLI Sbjct: 1 MLKTRPPSFLSPY--HLPLSNLNFQTQKEHHQTLTERLLSLIKQCKSKNLLKQIHAQMLI 58 Query: 154 NSIHKPNFLLSKLILLKDFEYSTFFFSQIPNVNDYAFNIMIRGLTTTWQKF 2 NSI KPNFLLSK+I LKD Y++ F+Q+ N YAFN+M+RGL TTW+K+ Sbjct: 59 NSIPKPNFLLSKIIDLKDLAYASLVFNQLTKPNIYAFNVMLRGLATTWKKY 109 >ref|XP_011081745.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Sesamum indicum] gi|747069874|ref|XP_011081746.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Sesamum indicum] Length = 622 Score = 107 bits (266), Expect = 4e-21 Identities = 51/79 (64%), Positives = 66/79 (83%), Gaps = 2/79 (2%) Frame = -3 Query: 232 IDQILFLLRKCKSTQTVRQIHSQMLINSIH--KPNFLLSKLILLKDFEYSTFFFSQIPNV 59 I Q+L LL++CKST++V+Q+H+QMLI+S+ PN+LLSK+I LKDF YST FF+QIP + Sbjct: 26 ISQLLVLLKQCKSTRSVQQVHTQMLIHSVQMPMPNYLLSKIIELKDFSYSTIFFAQIP-I 84 Query: 58 NDYAFNIMIRGLTTTWQKF 2 N YAFN+MIRG TTWQKF Sbjct: 85 NSYAFNVMIRGFATTWQKF 103 >ref|XP_002532091.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528238|gb|EEF30293.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 446 Score = 106 bits (265), Expect = 5e-21 Identities = 47/83 (56%), Positives = 67/83 (80%) Frame = -3 Query: 250 HHHPTLIDQILFLLRKCKSTQTVRQIHSQMLINSIHKPNFLLSKLILLKDFEYSTFFFSQ 71 H TL ++L LL++C+S + ++QIH+QM+INS+ KPNFLL ++I LKDF Y++ F+Q Sbjct: 26 HQLQTLTVKLLKLLKQCRSKKPMQQIHAQMIINSLSKPNFLLPRIIDLKDFAYASLLFTQ 85 Query: 70 IPNVNDYAFNIMIRGLTTTWQKF 2 +PN NDYAFN+MIRGLTTTW+ + Sbjct: 86 MPNPNDYAFNVMIRGLTTTWRNY 108 >ref|XP_002318172.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222858845|gb|EEE96392.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 617 Score = 106 bits (265), Expect = 5e-21 Identities = 48/96 (50%), Positives = 70/96 (72%) Frame = -3 Query: 289 HITIKIVARKYHDHHHPTLIDQILFLLRKCKSTQTVRQIHSQMLINSIHKPNFLLSKLIL 110 H+ + + + HH TL +++L L+++CKS ++QIH+QMLINSI KPNFLLSK+I Sbjct: 14 HLPLSNLNFQTQKEHHQTLTEKLLSLIKQCKSKNLLKQIHAQMLINSIPKPNFLLSKIID 73 Query: 109 LKDFEYSTFFFSQIPNVNDYAFNIMIRGLTTTWQKF 2 LKD Y++ F+Q+ N YAFN+M+RGL TTW+K+ Sbjct: 74 LKDLAYASLVFNQLTKPNIYAFNVMLRGLATTWKKY 109 >gb|KDO61856.1| hypothetical protein CISIN_1g042098mg [Citrus sinensis] Length = 566 Score = 105 bits (263), Expect = 9e-21 Identities = 50/81 (61%), Positives = 66/81 (81%), Gaps = 1/81 (1%) Frame = -3 Query: 241 PTLI-DQILFLLRKCKSTQTVRQIHSQMLINSIHKPNFLLSKLILLKDFEYSTFFFSQIP 65 P+L+ +++L LL+KC ST+TV+QIH+QMLIN I KPNFLL ++I LKDF Y++ F QI Sbjct: 20 PSLLREKLLSLLKKCPSTKTVQQIHTQMLINFIQKPNFLLIRIIDLKDFNYASLLFHQIS 79 Query: 64 NVNDYAFNIMIRGLTTTWQKF 2 N+YAFN+MIRGLTT WQK+ Sbjct: 80 RPNEYAFNVMIRGLTTAWQKY 100 >ref|XP_006474640.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400-like [Citrus sinensis] Length = 580 Score = 105 bits (263), Expect = 9e-21 Identities = 50/81 (61%), Positives = 66/81 (81%), Gaps = 1/81 (1%) Frame = -3 Query: 241 PTLI-DQILFLLRKCKSTQTVRQIHSQMLINSIHKPNFLLSKLILLKDFEYSTFFFSQIP 65 P+L+ +++L LL+KC ST+TV+QIH+QMLIN I KPNFLL ++I LKDF Y++ F QI Sbjct: 23 PSLLREKLLSLLKKCPSTKTVQQIHTQMLINFIQKPNFLLIRIIDLKDFNYASLLFHQIS 82 Query: 64 NVNDYAFNIMIRGLTTTWQKF 2 N+YAFN+MIRGLTT WQK+ Sbjct: 83 RPNEYAFNVMIRGLTTAWQKY 103 >ref|XP_006453289.1| hypothetical protein CICLE_v10010788mg, partial [Citrus clementina] gi|557556515|gb|ESR66529.1| hypothetical protein CICLE_v10010788mg, partial [Citrus clementina] Length = 572 Score = 105 bits (263), Expect = 9e-21 Identities = 50/81 (61%), Positives = 66/81 (81%), Gaps = 1/81 (1%) Frame = -3 Query: 241 PTLI-DQILFLLRKCKSTQTVRQIHSQMLINSIHKPNFLLSKLILLKDFEYSTFFFSQIP 65 P+L+ +++L LL+KC ST+TV+QIH+QMLIN I KPNFLL ++I LKDF Y++ F QI Sbjct: 20 PSLLREKLLSLLKKCPSTKTVQQIHTQMLINFIQKPNFLLIRIIDLKDFNYASLLFHQIS 79 Query: 64 NVNDYAFNIMIRGLTTTWQKF 2 N+YAFN+MIRGLTT WQK+ Sbjct: 80 RPNEYAFNVMIRGLTTAWQKY 100 >ref|XP_010091060.1| hypothetical protein L484_000436 [Morus notabilis] gi|587950857|gb|EXC36735.1| hypothetical protein L484_000436 [Morus notabilis] Length = 311 Score = 105 bits (262), Expect = 1e-20 Identities = 55/116 (47%), Positives = 79/116 (68%), Gaps = 7/116 (6%) Frame = -3 Query: 328 VLRTKIFINQF-SNHITIKI------VARKYHDHHHPTLIDQILFLLRKCKSTQTVRQIH 170 +LR+K+ + + S H+T++ + + + L +++L L+KC S + ++QI Sbjct: 1 MLRSKLPLQELISRHLTLQKSHINNPIINNNKKNPNQLLFEKLLSHLKKCISIKQLQQIQ 60 Query: 169 SQMLINSIHKPNFLLSKLILLKDFEYSTFFFSQIPNVNDYAFNIMIRGLTTTWQKF 2 +QMLINSIHKPNFLLSK I LK F Y++ F+ IP NDYAFN+MIRGLTTTWQK+ Sbjct: 61 TQMLINSIHKPNFLLSKAIDLKSFAYASALFAHIPEPNDYAFNVMIRGLTTTWQKY 116 >ref|XP_011462354.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Fragaria vesca subsp. vesca] Length = 632 Score = 104 bits (259), Expect = 3e-20 Identities = 47/75 (62%), Positives = 61/75 (81%) Frame = -3 Query: 226 QILFLLRKCKSTQTVRQIHSQMLINSIHKPNFLLSKLILLKDFEYSTFFFSQIPNVNDYA 47 ++L LL++C S + ++QIH+QMLINSIHKPNFLL KLI +DF Y++ FSQIP N YA Sbjct: 51 KLLHLLKQCLSIKELKQIHTQMLINSIHKPNFLLPKLIDFQDFPYASTLFSQIPEPNSYA 110 Query: 46 FNIMIRGLTTTWQKF 2 FN+M+RGLTTTW K+ Sbjct: 111 FNVMLRGLTTTWHKY 125 >ref|XP_004242849.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Solanum lycopersicum] gi|723713151|ref|XP_010323361.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Solanum lycopersicum] gi|723713158|ref|XP_010323362.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 [Solanum lycopersicum] Length = 622 Score = 104 bits (259), Expect = 3e-20 Identities = 55/109 (50%), Positives = 75/109 (68%), Gaps = 1/109 (0%) Frame = -3 Query: 325 LRTKIFINQFSNHITIKIVARKYHDHHHP-TLIDQILFLLRKCKSTQTVRQIHSQMLINS 149 LR K + S TI+ + +++ + Q+LFLL+KC + + V+Q H+QMLI S Sbjct: 3 LRAKSQQYKISRFFTIEATKQAFNNQQECFPITQQLLFLLKKCITIKQVQQSHAQMLIYS 62 Query: 148 IHKPNFLLSKLILLKDFEYSTFFFSQIPNVNDYAFNIMIRGLTTTWQKF 2 I K NFLLS++I LK+F+Y+T FS I + N+YAFNIMIRGLTTTWQKF Sbjct: 63 IDKANFLLSRIIDLKNFDYATLLFSHIHSPNEYAFNIMIRGLTTTWQKF 111