BLASTX nr result
ID: Forsythia21_contig00047718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00047718 (308 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012828099.1| PREDICTED: pentatricopeptide repeat-containi... 66 8e-09 ref|XP_011075332.1| PREDICTED: pentatricopeptide repeat-containi... 66 8e-09 >ref|XP_012828099.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Erythranthe guttatus] Length = 811 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = -1 Query: 161 MQKLLQTPIFRSIRARYIPPFSTFTSLSDYALDNHNIANEVLTLIDEVHPMEP 3 MQKLL +PIFRS+R + P STFTS D AL+N NIA EVL +I+ V+P++P Sbjct: 1 MQKLLHSPIFRSVRNHFFTPSSTFTSFPDNALENSNIATEVLAVINSVNPIQP 53 >ref|XP_011075332.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Sesamum indicum] Length = 806 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = -1 Query: 161 MQKLLQTPIFRSIRARYIPPFSTFTSLSDYALDNHNIANEVLTLIDEVHPMEP 3 MQK L +PIFRSI+ ++ P S+F SLSD AL+N NI NEVL LI+ VHP+ P Sbjct: 1 MQKFLHSPIFRSIKPQHFTPSSSFCSLSDNALENLNITNEVLALINSVHPIGP 53