BLASTX nr result
ID: Forsythia21_contig00047581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00047581 (234 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012856242.1| PREDICTED: uncharacterized protein LOC105975... 71 3e-10 emb|CAN61147.1| hypothetical protein VITISV_029170 [Vitis vinifera] 70 4e-10 ref|XP_007047232.1| EF hand calcium-binding protein family, puta... 67 5e-09 gb|KJB48567.1| hypothetical protein B456_008G075000 [Gossypium r... 66 8e-09 ref|XP_002523566.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 ref|XP_007204557.1| hypothetical protein PRUPE_ppa016540mg [Prun... 63 7e-08 ref|XP_002310149.2| hypothetical protein POPTR_0007s11150g [Popu... 60 7e-07 gb|KDP31919.1| hypothetical protein JCGZ_12380 [Jatropha curcas] 59 1e-06 >ref|XP_012856242.1| PREDICTED: uncharacterized protein LOC105975587 [Erythranthe guttatus] gi|604345894|gb|EYU44391.1| hypothetical protein MIMGU_mgv1a025323mg [Erythranthe guttata] Length = 100 Score = 70.9 bits (172), Expect = 3e-10 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -2 Query: 233 GWWKARRGMKAVDSDHTGHIDNTNEIEKLVKYAQQQLSLKIYENED 96 GWWKARR MKA DS+ TGHID+ E+EKLV+YAQQQL +KIY+ D Sbjct: 53 GWWKARRCMKASDSNRTGHIDSAVEMEKLVQYAQQQLHMKIYDYND 98 >emb|CAN61147.1| hypothetical protein VITISV_029170 [Vitis vinifera] Length = 97 Score = 70.5 bits (171), Expect = 4e-10 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -2 Query: 233 GWWKARRGMKAVDSDHTGHIDNTNEIEKLVKYAQQQLSLKIYEN 102 GWWKAR+GMK D+DH+G IDNT E+EKLV+YAQ L +KI EN Sbjct: 52 GWWKARQGMKEADTDHSGRIDNTKEMEKLVQYAQHHLHMKISEN 95 >ref|XP_007047232.1| EF hand calcium-binding protein family, putative [Theobroma cacao] gi|508699493|gb|EOX91389.1| EF hand calcium-binding protein family, putative [Theobroma cacao] Length = 167 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -2 Query: 233 GWWKARRGMKAVDSDHTGHIDNTNEIEKLVKYAQQQLSLKIYENEDC 93 GWWKAR+ MK DS+H G I+N EIEKLV YAQQ+L +KIY++ DC Sbjct: 53 GWWKARQAMKEADSNHDGQIENGKEIEKLVNYAQQRLHMKIYQS-DC 98 >gb|KJB48567.1| hypothetical protein B456_008G075000 [Gossypium raimondii] Length = 97 Score = 66.2 bits (160), Expect = 8e-09 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -2 Query: 233 GWWKARRGMKAVDSDHTGHIDNTNEIEKLVKYAQQQLSLKIYENE 99 GWWKAR+GMK D +H G I+N EIEKLV YAQ++L +KIY+++ Sbjct: 52 GWWKARQGMKEADCNHDGQIENAKEIEKLVNYAQKRLHMKIYQSD 96 >ref|XP_002523566.1| conserved hypothetical protein [Ricinus communis] gi|223537128|gb|EEF38761.1| conserved hypothetical protein [Ricinus communis] Length = 95 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -2 Query: 230 WWKARRGMKAVDSDHTGHIDNTNEIEKLVKYAQQQLSLKIYEN 102 WWK+R+ MK VD+D G IDN EIEKL+KYAQQ+L +KI+EN Sbjct: 53 WWKSRQAMKEVDTDRNGLIDNPKEIEKLIKYAQQRLHMKIHEN 95 >ref|XP_007204557.1| hypothetical protein PRUPE_ppa016540mg [Prunus persica] gi|462400088|gb|EMJ05756.1| hypothetical protein PRUPE_ppa016540mg [Prunus persica] Length = 98 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -2 Query: 233 GWWKARRGMKAVDSDHTGHIDNTNEIEKLVKYAQQQLSLKIYEN 102 GWW+AR+GMK D + +G IDN E EKLV YAQQ+L +KI EN Sbjct: 52 GWWRARQGMKQADCNKSGQIDNPKEFEKLVSYAQQRLGMKILEN 95 >ref|XP_002310149.2| hypothetical protein POPTR_0007s11150g [Populus trichocarpa] gi|550334633|gb|EEE90599.2| hypothetical protein POPTR_0007s11150g [Populus trichocarpa] Length = 107 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -2 Query: 230 WWKARRGMKAVDSDHTGHIDNTNEIEKLVKYAQQQLSLKIYENED 96 WWKAR+ MK D++H G I+ EIEKLV YAQQ L +KI+ + D Sbjct: 53 WWKARQVMKVADTNHNGQIEGVEEIEKLVNYAQQHLHMKIHRSHD 97 >gb|KDP31919.1| hypothetical protein JCGZ_12380 [Jatropha curcas] Length = 97 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -2 Query: 230 WWKARRGMKAVDSDHTGHIDNTNEIEKLVKYAQQQLSLKIYENE 99 WWKAR+ MK D++ GHIDN EIEKL+ YAQ++L +KI ++ Sbjct: 53 WWKARQAMKEADTNSNGHIDNPKEIEKLINYAQKRLHMKIQRSD 96