BLASTX nr result
ID: Forsythia21_contig00047439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00047439 (429 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094220.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_012828652.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 >ref|XP_011094220.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 [Sesamum indicum] Length = 865 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/57 (64%), Positives = 46/57 (80%) Frame = -1 Query: 171 LHSENHGIITTHNRQTHRQYLGKLLLSSPQTSNNSIVYYKTVHAQIIVCGFENNVFL 1 L SENHG+ T H+RQ HRQYLG LLLS PQ + N ++Y +TVHAQII+ GFE+N+FL Sbjct: 46 LESENHGVFTMHSRQKHRQYLGSLLLSLPQNTVNPVLYCRTVHAQIILSGFESNLFL 102 >ref|XP_012828652.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 [Erythranthe guttatus] Length = 817 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/61 (55%), Positives = 42/61 (68%), Gaps = 1/61 (1%) Frame = -1 Query: 180 SPFLHSENHG-IITTHNRQTHRQYLGKLLLSSPQTSNNSIVYYKTVHAQIIVCGFENNVF 4 S L S+N G + HNRQ HRQYLGKLLLS P+ +++ YYKTVH QII G +N+F Sbjct: 42 SQLLQSDNSGSTVAAHNRQKHRQYLGKLLLSPPENITDNVRYYKTVHGQIISSGLASNIF 101 Query: 3 L 1 L Sbjct: 102 L 102