BLASTX nr result
ID: Forsythia21_contig00047395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00047395 (285 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESZ96370.1| hypothetical protein SBOR_3253 [Sclerotinia borea... 59 1e-06 ref|XP_001595142.1| hypothetical protein SS1G_03230 [Sclerotinia... 59 1e-06 >gb|ESZ96370.1| hypothetical protein SBOR_3253 [Sclerotinia borealis F-4157] Length = 252 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -2 Query: 284 FVKPDSPEQIYAQSEQFEVSGVAASATSTLAGYTGPTFT 168 FV PD PEQI AQS+QF V+GVA+SA+STLAGYTG + T Sbjct: 95 FVSPDKPEQILAQSQQFTVNGVASSASSTLAGYTGASST 133 >ref|XP_001595142.1| hypothetical protein SS1G_03230 [Sclerotinia sclerotiorum 1980] gi|154701018|gb|EDO00757.1| hypothetical protein SS1G_03230 [Sclerotinia sclerotiorum 1980 UF-70] Length = 212 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -2 Query: 284 FVKPDSPEQIYAQSEQFEVSGVAASATSTLAGYTGPTFT 168 FV P PEQI AQS+QFEV GVA SA+STLAGYTG T T Sbjct: 95 FVSPGKPEQILAQSQQFEVKGVAESASSTLAGYTGTTST 133