BLASTX nr result
ID: Forsythia21_contig00047304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00047304 (259 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001806289.1| hypothetical protein SNOG_16163 [Phaeosphaer... 94 5e-17 ref|XP_003842043.1| similar to cysteine desulfurase [Leptosphaer... 93 6e-17 gb|KJX93663.1| cysteine desulfurase like protein [Zymoseptoria b... 93 8e-17 emb|CEJ93062.1| Putative Cysteine desulfurase [Torrubiella hemip... 92 1e-16 ref|XP_008027903.1| hypothetical protein SETTUDRAFT_177795 [Seto... 92 2e-16 ref|XP_003301994.1| hypothetical protein PTT_13663 [Pyrenophora ... 92 2e-16 ref|XP_001940059.1| cysteine desulfurase, mitochondrial precurso... 92 2e-16 gb|KFZ11514.1| hypothetical protein V501_04723 [Pseudogymnoascus... 91 2e-16 gb|KFY86984.1| hypothetical protein V500_07263 [Pseudogymnoascus... 91 2e-16 gb|KFY77822.1| hypothetical protein V499_02885 [Pseudogymnoascus... 91 2e-16 gb|KFY45126.1| hypothetical protein V495_03112 [Pseudogymnoascus... 91 2e-16 gb|KFY31027.1| hypothetical protein V493_01468 [Pseudogymnoascus... 91 2e-16 gb|KFX99658.1| hypothetical protein O988_03711 [Pseudogymnoascus... 91 2e-16 gb|KFX94504.1| hypothetical protein V490_04324 [Pseudogymnoascus... 91 2e-16 ref|XP_003856792.1| hypothetical protein MYCGRDRAFT_67552 [Zymos... 91 2e-16 gb|KKY32009.1| putative cysteine desulfurase [Diaporthe ampelina] 91 3e-16 ref|XP_007833885.1| Cysteine desulfurase [Pestalotiopsis fici W1... 91 3e-16 gb|KKP01867.1| cysteine desulfurase [Trichoderma harzianum] 91 4e-16 gb|KEF57405.1| cysteine desulfurase [Exophiala aquamarina CBS 11... 91 4e-16 gb|EHK16534.1| hypothetical protein TRIVIDRAFT_75378 [Trichoderm... 91 4e-16 >ref|XP_001806289.1| hypothetical protein SNOG_16163 [Phaeosphaeria nodorum SN15] gi|111055415|gb|EAT76535.1| hypothetical protein SNOG_16163 [Phaeosphaeria nodorum SN15] Length = 510 Score = 93.6 bits (231), Expect = 5e-17 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTDEEIDYVLKAVQERV+FLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 466 FTTDEEIDYVLKAVQERVSFLRELSPLWELVQEGVDLNTIEWSQH 510 >ref|XP_003842043.1| similar to cysteine desulfurase [Leptosphaeria maculans JN3] gi|312218619|emb|CBX98564.1| similar to cysteine desulfurase [Leptosphaeria maculans JN3] Length = 510 Score = 93.2 bits (230), Expect = 6e-17 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTD EIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 466 FTTDSEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 510 >gb|KJX93663.1| cysteine desulfurase like protein [Zymoseptoria brevis] Length = 509 Score = 92.8 bits (229), Expect = 8e-17 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTD+EIDYVLKAVQ+RVTFLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 465 FTTDDEIDYVLKAVQQRVTFLRELSPLWELVQEGVDLNTIEWSQH 509 >emb|CEJ93062.1| Putative Cysteine desulfurase [Torrubiella hemipterigena] Length = 498 Score = 92.0 bits (227), Expect = 1e-16 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTT+EEIDYVLKAVQERVTFLRELSPLWELVQEG+DLNTI+WSQH Sbjct: 454 FTTEEEIDYVLKAVQERVTFLRELSPLWELVQEGIDLNTIQWSQH 498 >ref|XP_008027903.1| hypothetical protein SETTUDRAFT_177795 [Setosphaeria turcica Et28A] gi|482807545|gb|EOA84481.1| hypothetical protein SETTUDRAFT_177795 [Setosphaeria turcica Et28A] Length = 504 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTD EIDYVLKAV+ERVTFLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 460 FTTDSEIDYVLKAVKERVTFLRELSPLWELVQEGVDLNTIEWSQH 504 >ref|XP_003301994.1| hypothetical protein PTT_13663 [Pyrenophora teres f. teres 0-1] gi|311322889|gb|EFQ89916.1| hypothetical protein PTT_13663 [Pyrenophora teres f. teres 0-1] Length = 505 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTD EIDYVLKAV+ERVTFLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 461 FTTDSEIDYVLKAVKERVTFLRELSPLWELVQEGVDLNTIEWSQH 505 >ref|XP_001940059.1| cysteine desulfurase, mitochondrial precursor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976152|gb|EDU42778.1| cysteine desulfurase, mitochondrial precursor [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 488 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTD EIDYVLKAV+ERVTFLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 444 FTTDSEIDYVLKAVKERVTFLRELSPLWELVQEGVDLNTIEWSQH 488 >gb|KFZ11514.1| hypothetical protein V501_04723 [Pseudogymnoascus pannorum VKM F-4519 (FW-2642)] Length = 516 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTD EIDYVLKAVQERV+FLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 472 FTTDAEIDYVLKAVQERVSFLRELSPLWELVQEGVDLNTIEWSQH 516 >gb|KFY86984.1| hypothetical protein V500_07263 [Pseudogymnoascus pannorum VKM F-4518 (FW-2643)] gi|682464758|gb|KFZ19715.1| hypothetical protein V502_03495 [Pseudogymnoascus pannorum VKM F-4520 (FW-2644)] Length = 516 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTD EIDYVLKAV+ERVTFLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 472 FTTDAEIDYVLKAVKERVTFLRELSPLWELVQEGVDLNTIEWSQH 516 >gb|KFY77822.1| hypothetical protein V499_02885 [Pseudogymnoascus pannorum VKM F-103] Length = 516 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTD EIDYVLKAVQERV+FLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 472 FTTDAEIDYVLKAVQERVSFLRELSPLWELVQEGVDLNTIEWSQH 516 >gb|KFY45126.1| hypothetical protein V495_03112 [Pseudogymnoascus pannorum VKM F-4514 (FW-929)] gi|682376468|gb|KFY60763.1| hypothetical protein V497_03396 [Pseudogymnoascus pannorum VKM F-4516 (FW-969)] Length = 516 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTD EIDYVLKAV+ERVTFLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 472 FTTDAEIDYVLKAVKERVTFLRELSPLWELVQEGVDLNTIEWSQH 516 >gb|KFY31027.1| hypothetical protein V493_01468 [Pseudogymnoascus pannorum VKM F-4281 (FW-2241)] Length = 516 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTD EIDYVLKAV+ERVTFLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 472 FTTDAEIDYVLKAVKERVTFLRELSPLWELVQEGVDLNTIEWSQH 516 >gb|KFX99658.1| hypothetical protein O988_03711 [Pseudogymnoascus pannorum VKM F-3808] Length = 516 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTD EIDYVLKAV+ERVTFLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 472 FTTDAEIDYVLKAVKERVTFLRELSPLWELVQEGVDLNTIEWSQH 516 >gb|KFX94504.1| hypothetical protein V490_04324 [Pseudogymnoascus pannorum VKM F-3557] Length = 516 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTD EIDYVLKAV+ERVTFLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 472 FTTDAEIDYVLKAVKERVTFLRELSPLWELVQEGVDLNTIEWSQH 516 >ref|XP_003856792.1| hypothetical protein MYCGRDRAFT_67552 [Zymoseptoria tritici IPO323] gi|339476677|gb|EGP91768.1| hypothetical protein MYCGRDRAFT_67552 [Zymoseptoria tritici IPO323] Length = 509 Score = 91.3 bits (225), Expect = 2e-16 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTD+EI+YVLKAVQ+RVTFLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 465 FTTDDEIEYVLKAVQQRVTFLRELSPLWELVQEGVDLNTIEWSQH 509 >gb|KKY32009.1| putative cysteine desulfurase [Diaporthe ampelina] Length = 513 Score = 90.9 bits (224), Expect = 3e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTTD EIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTI+WSQH Sbjct: 469 FTTDLEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIQWSQH 513 >ref|XP_007833885.1| Cysteine desulfurase [Pestalotiopsis fici W106-1] gi|573062403|gb|ETS82111.1| Cysteine desulfurase [Pestalotiopsis fici W106-1] Length = 509 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTT+ EIDYVLKAVQERVTFLRELSPLWELVQEG+DLNTIEWSQH Sbjct: 465 FTTEAEIDYVLKAVQERVTFLRELSPLWELVQEGIDLNTIEWSQH 509 >gb|KKP01867.1| cysteine desulfurase [Trichoderma harzianum] Length = 503 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTT+EEIDYVLKAV+ERVTFLRELSPLWELVQEG+DLNTI+WSQH Sbjct: 459 FTTEEEIDYVLKAVRERVTFLRELSPLWELVQEGIDLNTIQWSQH 503 >gb|KEF57405.1| cysteine desulfurase [Exophiala aquamarina CBS 119918] Length = 515 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTT EIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH Sbjct: 471 FTTTSEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 515 >gb|EHK16534.1| hypothetical protein TRIVIDRAFT_75378 [Trichoderma virens Gv29-8] Length = 503 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = -3 Query: 257 FTTDEEIDYVLKAVQERVTFLRELSPLWELVQEGVDLNTIEWSQH 123 FTT+EEIDYVLKAV+ERVTFLRELSPLWELVQEG+DLNTI+WSQH Sbjct: 459 FTTEEEIDYVLKAVRERVTFLRELSPLWELVQEGIDLNTIQWSQH 503