BLASTX nr result
ID: Forsythia21_contig00047254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00047254 (349 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012841522.1| PREDICTED: putative late blight resistance p... 65 2e-08 gb|EYU33968.1| hypothetical protein MIMGU_mgv1a026820mg, partial... 65 2e-08 gb|EYU24356.1| hypothetical protein MIMGU_mgv1a022056mg [Erythra... 64 3e-08 ref|XP_011072558.1| PREDICTED: putative late blight resistance p... 63 7e-08 ref|XP_012829174.1| PREDICTED: putative late blight resistance p... 62 1e-07 gb|EYU17661.1| hypothetical protein MIMGU_mgv1a025742mg, partial... 62 1e-07 gb|EYU21846.1| hypothetical protein MIMGU_mgv1a022576mg, partial... 62 2e-07 ref|XP_012827702.1| PREDICTED: putative late blight resistance p... 61 3e-07 ref|XP_012841521.1| PREDICTED: putative late blight resistance p... 60 4e-07 gb|EYU33966.1| hypothetical protein MIMGU_mgv1a001110mg [Erythra... 60 4e-07 ref|XP_011072559.1| PREDICTED: putative late blight resistance p... 60 6e-07 ref|XP_012856181.1| PREDICTED: putative late blight resistance p... 60 7e-07 ref|XP_012844379.1| PREDICTED: putative late blight resistance p... 60 7e-07 ref|XP_012841530.1| PREDICTED: putative late blight resistance p... 60 7e-07 gb|EYU31598.1| hypothetical protein MIMGU_mgv1a018432mg [Erythra... 60 7e-07 gb|EYU21847.1| hypothetical protein MIMGU_mgv1a017843mg, partial... 60 7e-07 ref|XP_012853931.1| PREDICTED: putative late blight resistance p... 59 1e-06 gb|EYU23518.1| hypothetical protein MIMGU_mgv1a019595mg [Erythra... 59 1e-06 ref|XP_012856349.1| PREDICTED: putative late blight resistance p... 59 1e-06 ref|XP_012856180.1| PREDICTED: putative late blight resistance p... 59 1e-06 >ref|XP_012841522.1| PREDICTED: putative late blight resistance protein homolog R1A-10 [Erythranthe guttatus] Length = 886 Score = 64.7 bits (156), Expect = 2e-08 Identities = 40/94 (42%), Positives = 51/94 (54%), Gaps = 11/94 (11%) Frame = -3 Query: 260 INSRLLSVFDTNDTSVNEFP----------VNLRYFACNFDFAR-SFPASQLHLLRNLQT 114 +N RLL V +ND +++ VN RY A D+ + S S LHLL NLQT Sbjct: 544 LNMRLLRVLKSNDRALHYGDIYSIEAIFQLVNSRYLAIRVDWMQISLYLSSLHLLWNLQT 603 Query: 113 LMCSDFVNIYLPPEIWEMRQLRHVNFWEMVLPDP 12 L+ N PPEIW+M QLRH+ F + LPDP Sbjct: 604 LIVYGAWNTIAPPEIWKMHQLRHIEFVMLDLPDP 637 >gb|EYU33968.1| hypothetical protein MIMGU_mgv1a026820mg, partial [Erythranthe guttata] Length = 880 Score = 64.7 bits (156), Expect = 2e-08 Identities = 40/94 (42%), Positives = 51/94 (54%), Gaps = 11/94 (11%) Frame = -3 Query: 260 INSRLLSVFDTNDTSVNEFP----------VNLRYFACNFDFAR-SFPASQLHLLRNLQT 114 +N RLL V +ND +++ VN RY A D+ + S S LHLL NLQT Sbjct: 546 LNMRLLRVLKSNDRALHYGDIYSIEAIFQLVNSRYLAIRVDWMQISLYLSSLHLLWNLQT 605 Query: 113 LMCSDFVNIYLPPEIWEMRQLRHVNFWEMVLPDP 12 L+ N PPEIW+M QLRH+ F + LPDP Sbjct: 606 LIVYGAWNTIAPPEIWKMHQLRHIEFVMLDLPDP 639 >gb|EYU24356.1| hypothetical protein MIMGU_mgv1a022056mg [Erythranthe guttata] Length = 775 Score = 64.3 bits (155), Expect = 3e-08 Identities = 40/96 (41%), Positives = 56/96 (58%), Gaps = 11/96 (11%) Frame = -3 Query: 257 NSRLLSVFDTNDTSVNEF---------PVNLRYFACN--FDFARSFPASQLHLLRNLQTL 111 N+RLL V + D S+++ VNLRY N + P+S + LL N+QTL Sbjct: 463 NNRLLRVLNVYDNSLSKKIYLSKCIFDQVNLRYLGYNTQLNIYGELPSS-ISLLWNMQTL 521 Query: 110 MCSDFVNIYLPPEIWEMRQLRHVNFWEMVLPDPPSA 3 + NI+ P EIWEMRQLRH++ + + LPDPPS+ Sbjct: 522 IIEG--NIFAPSEIWEMRQLRHMDIYRLYLPDPPSS 555 >ref|XP_011072558.1| PREDICTED: putative late blight resistance protein homolog R1B-16 [Sesamum indicum] Length = 742 Score = 63.2 bits (152), Expect = 7e-08 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 4/69 (5%) Frame = -3 Query: 200 VNLRY--FACNFDFARSFPASQLHLLRNLQTLMC--SDFVNIYLPPEIWEMRQLRHVNFW 33 VNL+Y F+ + + SFP+S +HLL NLQTL+ +D IY PPEIW+M QLRHV Sbjct: 431 VNLQYLAFSAEMNLSSSFPSS-MHLLWNLQTLIVKRTDGQLIYAPPEIWKMHQLRHVQVP 489 Query: 32 EMVLPDPPS 6 + LPDPP+ Sbjct: 490 GLGLPDPPT 498 >ref|XP_012829174.1| PREDICTED: putative late blight resistance protein homolog R1B-16 [Erythranthe guttatus] Length = 949 Score = 62.4 bits (150), Expect = 1e-07 Identities = 39/94 (41%), Positives = 56/94 (59%), Gaps = 9/94 (9%) Frame = -3 Query: 263 LINSRLLSVFDT--NDTSVNEF---PVNLRYF----ACNFDFARSFPASQLHLLRNLQTL 111 ++ RLL VFD N++ +++ VNLRYF + F P+S ++LL NLQTL Sbjct: 609 MLKFRLLRVFDVLGNNSPLDDVLDKQVNLRYFRKLYGWEYRFFHVLPSS-IYLLWNLQTL 667 Query: 110 MCSDFVNIYLPPEIWEMRQLRHVNFWEMVLPDPP 9 + ++ PPEIW+M QLRHV+ M LP+PP Sbjct: 668 IIRQGESVIAPPEIWKMPQLRHVDCVNMYLPEPP 701 >gb|EYU17661.1| hypothetical protein MIMGU_mgv1a025742mg, partial [Erythranthe guttata] Length = 726 Score = 62.4 bits (150), Expect = 1e-07 Identities = 39/94 (41%), Positives = 56/94 (59%), Gaps = 9/94 (9%) Frame = -3 Query: 263 LINSRLLSVFDT--NDTSVNEF---PVNLRYF----ACNFDFARSFPASQLHLLRNLQTL 111 ++ RLL VFD N++ +++ VNLRYF + F P+S ++LL NLQTL Sbjct: 386 MLKFRLLRVFDVLGNNSPLDDVLDKQVNLRYFRKLYGWEYRFFHVLPSS-IYLLWNLQTL 444 Query: 110 MCSDFVNIYLPPEIWEMRQLRHVNFWEMVLPDPP 9 + ++ PPEIW+M QLRHV+ M LP+PP Sbjct: 445 IIRQGESVIAPPEIWKMPQLRHVDCVNMYLPEPP 478 >gb|EYU21846.1| hypothetical protein MIMGU_mgv1a022576mg, partial [Erythranthe guttata] Length = 348 Score = 61.6 bits (148), Expect = 2e-07 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 4/90 (4%) Frame = -3 Query: 266 KLINSRLLSVFDTNDTSVNEF--PVNLRYFACNFDFAR--SFPASQLHLLRNLQTLMCSD 99 K ++ L S ++ N S+ + VNLR+ A D+ + +FP+S ++LL NLQTL+ Sbjct: 14 KAVDENLYS-YEENSYSLEDVFRLVNLRFLAIGADWRQIPTFPSS-VYLLWNLQTLIVKG 71 Query: 98 FVNIYLPPEIWEMRQLRHVNFWEMVLPDPP 9 + PPEIW+M QLRHV F ++ +PDPP Sbjct: 72 IDDAVAPPEIWKMPQLRHVQFDQLEMPDPP 101 >ref|XP_012827702.1| PREDICTED: putative late blight resistance protein homolog R1A-3 [Erythranthe guttatus] Length = 891 Score = 60.8 bits (146), Expect = 3e-07 Identities = 44/116 (37%), Positives = 63/116 (54%), Gaps = 16/116 (13%) Frame = -3 Query: 305 VLNFDEGHYHQSEKLINSRLLSVFDTNDTSV-------NEFPV-------NLRYFACNFD 168 + NF+EG L++ RLL V +D + E+ V NLR+ A D Sbjct: 542 ICNFEEGL-----PLLDFRLLRVLKVDDKKLLNDNNRQYEYSVEVVFRLVNLRFIAIQSD 596 Query: 167 FARS--FPASQLHLLRNLQTLMCSDFVNIYLPPEIWEMRQLRHVNFWEMVLPDPPS 6 +S FP+S ++LL NLQTL+ + ++ P EIW M QL+HVNF + LPDPP+ Sbjct: 597 GPKSSGFPSS-VNLLWNLQTLVVNGTWDVVAPCEIWNMTQLKHVNFDRLELPDPPT 651 >ref|XP_012841521.1| PREDICTED: putative late blight resistance protein homolog R1B-16 [Erythranthe guttatus] Length = 890 Score = 60.5 bits (145), Expect = 4e-07 Identities = 40/94 (42%), Positives = 51/94 (54%), Gaps = 11/94 (11%) Frame = -3 Query: 260 INSRLLSVFDTND--------TSVNEF--PVNLRYFACNFDFAR-SFPASQLHLLRNLQT 114 +N+++L V +ND +SV VNLRY A D+ S S LHLL NLQT Sbjct: 548 LNTKMLRVLKSNDRALYYGETSSVEAIFRLVNLRYLAFRVDWMSISNHLSSLHLLWNLQT 607 Query: 113 LMCSDFVNIYLPPEIWEMRQLRHVNFWEMVLPDP 12 L+ PPEIW+M QLRH+ F + LPDP Sbjct: 608 LIVYGAWKTKAPPEIWKMHQLRHIEFIMLDLPDP 641 >gb|EYU33966.1| hypothetical protein MIMGU_mgv1a001110mg [Erythranthe guttata] Length = 887 Score = 60.5 bits (145), Expect = 4e-07 Identities = 40/94 (42%), Positives = 51/94 (54%), Gaps = 11/94 (11%) Frame = -3 Query: 260 INSRLLSVFDTND--------TSVNEF--PVNLRYFACNFDFAR-SFPASQLHLLRNLQT 114 +N+++L V +ND +SV VNLRY A D+ S S LHLL NLQT Sbjct: 548 LNTKMLRVLKSNDRALYYGETSSVEAIFRLVNLRYLAFRVDWMSISNHLSSLHLLWNLQT 607 Query: 113 LMCSDFVNIYLPPEIWEMRQLRHVNFWEMVLPDP 12 L+ PPEIW+M QLRH+ F + LPDP Sbjct: 608 LIVYGAWKTKAPPEIWKMHQLRHIEFIMLDLPDP 641 >ref|XP_011072559.1| PREDICTED: putative late blight resistance protein homolog R1B-16 [Sesamum indicum] Length = 318 Score = 60.1 bits (144), Expect = 6e-07 Identities = 34/68 (50%), Positives = 44/68 (64%), Gaps = 5/68 (7%) Frame = -3 Query: 200 VNLRYFACNFDF---ARSFPASQLHLLRNLQTLMC--SDFVNIYLPPEIWEMRQLRHVNF 36 VN RY + D +R P+ +HLL NLQTL+ SD+ IY PPEIW+M QLRHV+ Sbjct: 8 VNCRYLVFSVDINLNSRFLPS--MHLLWNLQTLIIEDSDWRRIYAPPEIWKMHQLRHVHV 65 Query: 35 WEMVLPDP 12 + + LPDP Sbjct: 66 FRLNLPDP 73 >ref|XP_012856181.1| PREDICTED: putative late blight resistance protein homolog R1A-10 [Erythranthe guttatus] Length = 880 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/66 (46%), Positives = 44/66 (66%), Gaps = 2/66 (3%) Frame = -3 Query: 200 VNLRYFACNFDFARS--FPASQLHLLRNLQTLMCSDFVNIYLPPEIWEMRQLRHVNFWEM 27 VNLR+ A D ++ FP S ++LL NLQTL+ + + P EIW M QL+HV+F+++ Sbjct: 586 VNLRFIAIRSDVPKNSGFP-SLVNLLWNLQTLIVNGIFGVVAPCEIWNMTQLKHVHFFQL 644 Query: 26 VLPDPP 9 LPDPP Sbjct: 645 KLPDPP 650 >ref|XP_012844379.1| PREDICTED: putative late blight resistance protein homolog R1B-17 [Erythranthe guttatus] Length = 613 Score = 59.7 bits (143), Expect = 7e-07 Identities = 41/110 (37%), Positives = 62/110 (56%), Gaps = 16/110 (14%) Frame = -3 Query: 284 HYHQSEKLINSRLLSVFDTND-------TSVNEFPV-------NLRYFACNFDFARS--F 153 ++ + L++ RLL V +D + NE+ V NLR+ A D +S F Sbjct: 382 NFEERLPLLDFRLLRVLKADDKKSYIDNSRQNEYSVDVVFRLVNLRFIAIRSDRPKSTGF 441 Query: 152 PASQLHLLRNLQTLMCSDFVNIYLPPEIWEMRQLRHVNFWEMVLPDPPSA 3 P+S ++LL NLQTL+ + ++ P EIW M QL+HV+F+ + LPDPP A Sbjct: 442 PSS-VNLLWNLQTLIVNCNWSVVAPCEIWNMTQLKHVHFYGLELPDPPIA 490 >ref|XP_012841530.1| PREDICTED: putative late blight resistance protein homolog R1A-3 [Erythranthe guttatus] gi|604328335|gb|EYU33970.1| hypothetical protein MIMGU_mgv1a018989mg [Erythranthe guttata] Length = 895 Score = 59.7 bits (143), Expect = 7e-07 Identities = 38/94 (40%), Positives = 50/94 (53%), Gaps = 11/94 (11%) Frame = -3 Query: 260 INSRLLSVFDTNDTSVNEFP----------VNLRYFACNFDFAR-SFPASQLHLLRNLQT 114 +N RLL V +ND +++ VN RY A D+ + S S LH + NLQT Sbjct: 553 LNMRLLRVLKSNDRALHYGDIYSIEAIFQLVNSRYLAFRVDWMQISKYLSSLHHIWNLQT 612 Query: 113 LMCSDFVNIYLPPEIWEMRQLRHVNFWEMVLPDP 12 L+ N PPEIW+M QLRH+ F + LPDP Sbjct: 613 LIVYGAWNTIAPPEIWKMHQLRHIEFIMLDLPDP 646 >gb|EYU31598.1| hypothetical protein MIMGU_mgv1a018432mg [Erythranthe guttata] Length = 852 Score = 59.7 bits (143), Expect = 7e-07 Identities = 41/110 (37%), Positives = 62/110 (56%), Gaps = 16/110 (14%) Frame = -3 Query: 284 HYHQSEKLINSRLLSVFDTND-------TSVNEFPV-------NLRYFACNFDFARS--F 153 ++ + L++ RLL V +D + NE+ V NLR+ A D +S F Sbjct: 533 NFEERLPLLDFRLLRVLKADDKKSYIDNSRQNEYSVDVVFRLVNLRFIAIRSDRPKSTGF 592 Query: 152 PASQLHLLRNLQTLMCSDFVNIYLPPEIWEMRQLRHVNFWEMVLPDPPSA 3 P+S ++LL NLQTL+ + ++ P EIW M QL+HV+F+ + LPDPP A Sbjct: 593 PSS-VNLLWNLQTLIVNCNWSVVAPCEIWNMTQLKHVHFYGLELPDPPIA 641 >gb|EYU21847.1| hypothetical protein MIMGU_mgv1a017843mg, partial [Erythranthe guttata] Length = 857 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/66 (46%), Positives = 44/66 (66%), Gaps = 2/66 (3%) Frame = -3 Query: 200 VNLRYFACNFDFARS--FPASQLHLLRNLQTLMCSDFVNIYLPPEIWEMRQLRHVNFWEM 27 VNLR+ A D ++ FP S ++LL NLQTL+ + + P EIW M QL+HV+F+++ Sbjct: 563 VNLRFIAIRSDVPKNSGFP-SLVNLLWNLQTLIVNGIFGVVAPCEIWNMTQLKHVHFFQL 621 Query: 26 VLPDPP 9 LPDPP Sbjct: 622 KLPDPP 627 >ref|XP_012853931.1| PREDICTED: putative late blight resistance protein homolog R1B-16 [Erythranthe guttatus] Length = 884 Score = 59.3 bits (142), Expect = 1e-06 Identities = 40/98 (40%), Positives = 49/98 (50%), Gaps = 9/98 (9%) Frame = -3 Query: 272 SEKLINSRLLSVFDTNDTSVNEF-------PVNLRYFACNFDFARSFPA--SQLHLLRNL 120 + +L N+RLL V N + VN+RY A N S S + +L NL Sbjct: 535 NSRLSNNRLLRVMSFNVEPDENYLRWHIVDKVNMRYLAYNKYVVSSLVKLPSSMSVLWNL 594 Query: 119 QTLMCSDFVNIYLPPEIWEMRQLRHVNFWEMVLPDPPS 6 QT+ I PPEIWEMRQLRHV W + L DPPS Sbjct: 595 QTIYIER--EIEAPPEIWEMRQLRHVTIWGLHLHDPPS 630 >gb|EYU23518.1| hypothetical protein MIMGU_mgv1a019595mg [Erythranthe guttata] Length = 901 Score = 59.3 bits (142), Expect = 1e-06 Identities = 40/98 (40%), Positives = 49/98 (50%), Gaps = 9/98 (9%) Frame = -3 Query: 272 SEKLINSRLLSVFDTNDTSVNEF-------PVNLRYFACNFDFARSFPA--SQLHLLRNL 120 + +L N+RLL V N + VN+RY A N S S + +L NL Sbjct: 535 NSRLSNNRLLRVMSFNVEPDENYLRWHIVDKVNMRYLAYNKYVVSSLVKLPSSMSVLWNL 594 Query: 119 QTLMCSDFVNIYLPPEIWEMRQLRHVNFWEMVLPDPPS 6 QT+ I PPEIWEMRQLRHV W + L DPPS Sbjct: 595 QTIYIER--EIEAPPEIWEMRQLRHVTIWGLHLHDPPS 630 >ref|XP_012856349.1| PREDICTED: putative late blight resistance protein homolog R1B-16 isoform X1 [Erythranthe guttatus] Length = 935 Score = 58.9 bits (141), Expect = 1e-06 Identities = 32/65 (49%), Positives = 42/65 (64%), Gaps = 2/65 (3%) Frame = -3 Query: 197 NLRYFACNFDFARS--FPASQLHLLRNLQTLMCSDFVNIYLPPEIWEMRQLRHVNFWEMV 24 N R+ A D ++ FP+S ++LL NLQTL+ D V P EIW+M QLRHV F E+ Sbjct: 628 NSRFIAIRVDSRQNPQFPSS-VNLLWNLQTLIVKDTVGAVAPSEIWKMTQLRHVEFDELE 686 Query: 23 LPDPP 9 +PDPP Sbjct: 687 MPDPP 691 >ref|XP_012856180.1| PREDICTED: putative late blight resistance protein homolog R1B-16 [Erythranthe guttatus] Length = 357 Score = 58.9 bits (141), Expect = 1e-06 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 16/100 (16%) Frame = -3 Query: 260 INSRLLSVFDTNDTSVN-------EFPV-------NLRYFACNFDFARS--FPASQLHLL 129 ++ RLL V T D ++ ++P+ N R+ A D+ ++ FP+S ++LL Sbjct: 18 LDFRLLRVLKTVDKHLHSEEKRQYKYPIEVVFRLFNSRFIAIRVDWRQNPQFPSS-VNLL 76 Query: 128 RNLQTLMCSDFVNIYLPPEIWEMRQLRHVNFWEMVLPDPP 9 NLQTL+ D V P EIW+M QLRHV F + LPDPP Sbjct: 77 WNLQTLIVKDTVGAVAPSEIWKMTQLRHVEFDGLELPDPP 116