BLASTX nr result
ID: Forsythia21_contig00047199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00047199 (286 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087252.1| PREDICTED: putative pentatricopeptide repeat... 64 5e-08 >ref|XP_011087252.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g05240 isoform X1 [Sesamum indicum] Length = 674 Score = 63.5 bits (153), Expect = 5e-08 Identities = 37/77 (48%), Positives = 44/77 (57%) Frame = -2 Query: 285 LLQLHSQLIXXXXXXXXXXXXXXXXXXXXSNPSTFPYATTLFHQIQEPKNCSLKWNHMIR 106 L Q+HS LI S+PST +AT+LFH+IQEP KWN MIR Sbjct: 27 LFQVHSLLITTGLQSQHPSTLLSLLKLYLSHPSTLAHATSLFHRIQEPS----KWNLMIR 82 Query: 105 HTSNTNPLKALSLFQEM 55 H S T+PL+AL LFQEM Sbjct: 83 HASATSPLRALFLFQEM 99