BLASTX nr result
ID: Forsythia21_contig00047155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00047155 (505 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082960.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 >ref|XP_011082960.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01860 [Sesamum indicum] Length = 492 Score = 100 bits (250), Expect = 3e-19 Identities = 44/75 (58%), Positives = 59/75 (78%), Gaps = 1/75 (1%) Frame = +1 Query: 283 MDSLICSLYLYPISECNSATKVSRGILFVPRADSRRPYRRKLELPKNLRYPRRTRLPPDF 462 M+SL+C L+ YP+S C S T+ SRG++F R+DS++PY RKL+LPKNLR+ RRT PPDF Sbjct: 1 MESLLCCLFSYPVSNCGSITRFSRGVVFASRSDSKKPYHRKLQLPKNLRHRRRTEAPPDF 60 Query: 463 HPGL-RNVEELVPCD 504 HP L R+ EE +PC+ Sbjct: 61 HPVLHRDDEEQIPCE 75