BLASTX nr result
ID: Forsythia21_contig00047023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00047023 (310 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001806136.1| hypothetical protein SNOG_16005 [Phaeosphaer... 62 1e-07 >ref|XP_001806136.1| hypothetical protein SNOG_16005 [Phaeosphaeria nodorum SN15] gi|111055464|gb|EAT76584.1| hypothetical protein SNOG_16005 [Phaeosphaeria nodorum SN15] Length = 41 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 308 WTMGWGGKHAGGGVIVDKHGPRRAPFRFSFGKLNCFR 198 W G+GG+HAGGGV+ D+HG RRAPFR S G+ +CFR Sbjct: 5 WHKGFGGRHAGGGVVADRHGVRRAPFRLSCGRFSCFR 41