BLASTX nr result
ID: Forsythia21_contig00044653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00044653 (238 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098434.1| PREDICTED: zinc finger CCCH domain-containin... 59 2e-06 >ref|XP_011098434.1| PREDICTED: zinc finger CCCH domain-containing protein 41 [Sesamum indicum] Length = 951 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = -3 Query: 122 MELNVPSRKRRLSPSYCARDLDEKEISEGEDDDDDRNHKH 3 MEL V S K S S C D DEKEISEGED+DDDRNHKH Sbjct: 1 MELKVSSEKPGFSSSDCGSDPDEKEISEGEDEDDDRNHKH 40