BLASTX nr result
ID: Forsythia21_contig00044491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00044491 (457 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612373.1| Glutamate receptor 3.6 [Medicago truncatula] 57 4e-06 emb|CAN80304.1| hypothetical protein VITISV_017821 [Vitis vinifera] 57 4e-06 ref|XP_011073037.1| PREDICTED: retrovirus-related Pol polyprotei... 56 8e-06 >ref|XP_003612373.1| Glutamate receptor 3.6 [Medicago truncatula] Length = 449 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/64 (46%), Positives = 42/64 (65%) Frame = +2 Query: 263 MGSKVELEKFDGKGDFSLWKQKMKAILVQQRVSKALEDPEEYPETLKAKPDTILEMNEIA 442 MGSK ++EKF G DF LWK KM+A+L+QQ+ KAL+ P+T+ + T EM + A Sbjct: 1 MGSKWDIEKFTGINDFGLWKVKMQAVLIQQKCEKALKGEGALPDTMSQEEKT--EMMDKA 58 Query: 443 YSSI 454 S+I Sbjct: 59 RSAI 62 >emb|CAN80304.1| hypothetical protein VITISV_017821 [Vitis vinifera] Length = 939 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/65 (49%), Positives = 44/65 (67%), Gaps = 1/65 (1%) Frame = +2 Query: 263 MGS-KVELEKFDGKGDFSLWKQKMKAILVQQRVSKALEDPEEYPETLKAKPDTILEMNEI 439 MGS K E+E+F GK DF++W+ +MKAIL QQ V AL+D E P T+ AK + +++E Sbjct: 1 MGSIKSEIERFIGKNDFNVWRMRMKAILFQQGVKDALKDESELPVTMTAKEKS--DIDEK 58 Query: 440 AYSSI 454 AY I Sbjct: 59 AYHLI 63 >ref|XP_011073037.1| PREDICTED: retrovirus-related Pol polyprotein from transposon TNT 1-94 [Sesamum indicum] Length = 472 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = +2 Query: 281 LEKFDGKGDFSLWKQKMKAILVQQRVSKALEDPEEYPETLKAKPDTILEMNEIAYSSI 454 L+ FDGK DFS+W+QKMK IL+QQ+V KA++ +Y E + + LE +E AYSSI Sbjct: 6 LQPFDGKTDFSIWQQKMKGILIQQKVFKAIDG--KYAENITEEKK--LENDEFAYSSI 59