BLASTX nr result
ID: Forsythia21_contig00044460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00044460 (280 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843655.1| PREDICTED: serine/arginine-rich splicing fac... 65 2e-08 >ref|XP_012843655.1| PREDICTED: serine/arginine-rich splicing factor RS40-like isoform X1 [Erythranthe guttatus] Length = 259 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -2 Query: 138 PTILHFPETIAFAFLLTLLSIQFPTCSNIDIKFISDPVAGFAFVYM 1 P F ++ FAFL+TL S+QFPTC NIDI FI DPVAGFAFVYM Sbjct: 3 PPSYTFLRSLPFAFLMTLHSLQFPTCFNIDIMFIPDPVAGFAFVYM 48