BLASTX nr result
ID: Forsythia21_contig00044231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00044231 (364 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFM82503.1| later embryogenesis abundant protein [Nicotiana t... 57 6e-06 ref|XP_009620358.1| PREDICTED: late embryogenesis abundant prote... 57 6e-06 >gb|AFM82503.1| later embryogenesis abundant protein [Nicotiana tabacum] Length = 166 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 162 TVGIIQKTGEQVKSMAQGALDALKHTAGIATEDENAKKTNS 40 T GI+QKTGEQVKSMAQGA DA+KHT G+A DE+ T S Sbjct: 123 TGGILQKTGEQVKSMAQGAADAVKHTFGMADTDEDPTATKS 163 >ref|XP_009620358.1| PREDICTED: late embryogenesis abundant protein Dc3-like [Nicotiana tomentosiformis] Length = 166 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 162 TVGIIQKTGEQVKSMAQGALDALKHTAGIATEDENAKKTNS 40 T GI+QKTGEQVKSMAQGA DA+KHT G+A DE+ T S Sbjct: 123 TGGILQKTGEQVKSMAQGAADAVKHTFGMADTDEDPTATKS 163