BLASTX nr result
ID: Forsythia21_contig00044073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00044073 (278 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM86677.1| hypothetical protein ANO11243_046950 [fungal sp.... 65 2e-08 >dbj|GAM86677.1| hypothetical protein ANO11243_046950 [fungal sp. No.11243] Length = 181 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/84 (39%), Positives = 52/84 (61%) Frame = -2 Query: 253 SPSSTPVEPIITIKRKDNESACTAADIASGAVVNKWTATGYPTPLFLVNHTLSAIAFHRV 74 +P ST I +KR+ + D+ +G + + WT +GYP L VN +S I F ++ Sbjct: 34 APDST-----IYVKRRPG-TEFQQTDLHNGRIRHHWTVSGYPLALLQVNRRISEIVFSQL 87 Query: 73 WADSAVNINLTSADALCFLKYAIS 2 W ++A ++L+S+DALCFLKYA+S Sbjct: 88 WRETAFILSLSSSDALCFLKYALS 111