BLASTX nr result
ID: Forsythia21_contig00042979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00042979 (279 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF14989.1| CAP_N-domain-containing protein [Sphaerulina musi... 59 2e-06 gb|EMT66395.1| Adenylyl cyclase-associated protein [Fusarium oxy... 58 3e-06 >gb|EMF14989.1| CAP_N-domain-containing protein [Sphaerulina musiva SO2202] Length = 548 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 114 MAASTGMHNLTTLIKRLEAATSRLEDIASTSHPFD 10 MA +TGMHNLTTLIKRLEAATSRLEDIA++S +D Sbjct: 1 MATATGMHNLTTLIKRLEAATSRLEDIAASSQAYD 35 >gb|EMT66395.1| Adenylyl cyclase-associated protein [Fusarium oxysporum f. sp. cubense race 4] Length = 632 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/64 (48%), Positives = 37/64 (57%), Gaps = 10/64 (15%) Frame = -1 Query: 177 DQQTTLPCCPSPSPIRQEQP----------NMAASTGMHNLTTLIKRLEAATSRLEDIAS 28 D + T P P P+ + P N + MHNLTTLIKRLEAATSRLEDIAS Sbjct: 62 DSKATTPAAAKPEPVAEPLPESIEEFDAFLNTSVDKYMHNLTTLIKRLEAATSRLEDIAS 121 Query: 27 TSHP 16 ++ P Sbjct: 122 STEP 125