BLASTX nr result
ID: Forsythia21_contig00042978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00042978 (272 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME41472.1| hypothetical protein DOTSEDRAFT_73776 [Dothistrom... 69 2e-09 ref|XP_003853939.1| 60S ribosomal protein L13 [Zymoseptoria trit... 67 4e-09 ref|XP_007920980.1| hypothetical protein MYCFIDRAFT_87587 [Pseud... 64 4e-08 gb|EMF11016.1| ribosomal protein L13e [Sphaerulina musiva SO2202] 62 2e-07 gb|EKG20063.1| Ribosomal protein L13e [Macrophomina phaseolina MS6] 59 2e-06 >gb|EME41472.1| hypothetical protein DOTSEDRAFT_73776 [Dothistroma septosporum NZE10] Length = 217 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -3 Query: 246 VKFSNSALPINNKVVIQEEKLSENPSTENAYRTLRDARSEARLVG 112 VK SN A PI+NKVVI+E K+S+ P+TENAYR LRDARSEARLVG Sbjct: 155 VKHSNQAFPIDNKVVIKEGKISDFPATENAYRKLRDARSEARLVG 199 >ref|XP_003853939.1| 60S ribosomal protein L13 [Zymoseptoria tritici IPO323] gi|339473822|gb|EGP88915.1| hypothetical protein MYCGRDRAFT_103824 [Zymoseptoria tritici IPO323] gi|796691991|gb|KJX92394.1| 60s ribosomal protein l13 [Zymoseptoria brevis] Length = 220 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -3 Query: 246 VKFSNSALPINNKVVIQEEKLSENPSTENAYRTLRDARSEARLVG 112 VK SN A PI+NKVVI+E K+S+ P+TENAYR LRDARS+ARLVG Sbjct: 158 VKQSNKAFPIDNKVVIKEGKISDYPATENAYRVLRDARSDARLVG 202 >ref|XP_007920980.1| hypothetical protein MYCFIDRAFT_87587 [Pseudocercospora fijiensis CIRAD86] gi|452989093|gb|EME88848.1| hypothetical protein MYCFIDRAFT_87587 [Pseudocercospora fijiensis CIRAD86] Length = 222 Score = 63.9 bits (154), Expect = 4e-08 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -3 Query: 258 DGEHVKFSNSALPINNKVVIQEEKLSENPSTENAYRTLRDARSEARLVG 112 DG+ VK SN A PI+NKV I+E KLS+ P+TENAYR LR ARS+ARL+G Sbjct: 157 DGK-VKISNQAFPISNKVAIKEGKLSDYPATENAYRQLRVARSDARLIG 204 >gb|EMF11016.1| ribosomal protein L13e [Sphaerulina musiva SO2202] Length = 220 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -3 Query: 258 DGEHVKFSNSALPINNKVVIQEEKLSENPSTENAYRTLRDARSEARLVG 112 DG+ VK S A PI+NKVVI+E K+S+ P+TENAYR LR ARS+ARL G Sbjct: 155 DGK-VKLSKLAFPIDNKVVIKEGKISDYPATENAYRVLRTARSDARLAG 202 >gb|EKG20063.1| Ribosomal protein L13e [Macrophomina phaseolina MS6] Length = 216 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = -3 Query: 270 KAVRDGEHVKFSNSALPINNKVVIQEEKLSENPSTENAYRTLRDARSEARLVG 112 KAV+ GE+VK + PI +QE LS+ P+TENA+RTLR ARS+ARLVG Sbjct: 146 KAVKSGENVKSVATTFPITQAAGVQEGALSDFPATENAFRTLRIARSDARLVG 198