BLASTX nr result
ID: Forsythia21_contig00042875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00042875 (416 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011650806.1| PREDICTED: B3 domain-containing protein Os04... 74 5e-11 ref|XP_012831373.1| PREDICTED: B3 domain-containing protein Os04... 71 2e-10 ref|XP_012831419.1| PREDICTED: B3 domain-containing protein Os04... 69 9e-10 ref|XP_011086603.1| PREDICTED: B3 domain-containing protein REM1... 69 2e-09 ref|XP_010910571.1| PREDICTED: B3 domain-containing protein Os04... 69 2e-09 ref|XP_004307181.1| PREDICTED: B3 domain-containing protein Os04... 69 2e-09 ref|XP_004303740.1| PREDICTED: B3 domain-containing protein Os04... 68 2e-09 emb|CDP19806.1| unnamed protein product [Coffea canephora] 67 6e-09 ref|XP_004975400.1| PREDICTED: B3 domain-containing protein Os04... 67 6e-09 ref|XP_010943415.1| PREDICTED: B3 domain-containing protein Os04... 65 1e-08 emb|CDP07179.1| unnamed protein product [Coffea canephora] 65 1e-08 ref|XP_008802551.1| PREDICTED: B3 domain-containing protein Os04... 65 2e-08 ref|XP_009343238.1| PREDICTED: B3 domain-containing protein Os04... 65 2e-08 ref|XP_009343236.1| PREDICTED: B3 domain-containing protein Os04... 65 2e-08 ref|XP_004307182.1| PREDICTED: B3 domain-containing protein Os04... 65 2e-08 ref|XP_009341640.1| PREDICTED: B3 domain-containing protein Os04... 64 3e-08 ref|XP_009341637.1| PREDICTED: B3 domain-containing protein Os04... 64 3e-08 ref|XP_008776698.1| PREDICTED: B3 domain-containing protein Os04... 64 3e-08 ref|NP_001142732.1| uncharacterized protein LOC100275071 [Zea ma... 64 3e-08 ref|XP_004964321.1| PREDICTED: B3 domain-containing protein Os06... 64 4e-08 >ref|XP_011650806.1| PREDICTED: B3 domain-containing protein Os04g0386900-like [Cucumis sativus] gi|700201492|gb|KGN56625.1| hypothetical protein Csa_3G126890 [Cucumis sativus] Length = 147 Score = 73.6 bits (179), Expect = 5e-11 Identities = 30/72 (41%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = -2 Query: 214 EITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFGKTWEVKFCGER 35 E PL G+P++ +LSKSH+ P+Y++ P S+LP+ +P+++ C GK W++ + G R Sbjct: 20 ETMPLSGKPYHAFILSKSHVAPIYNLVLPAKFHSILPAIVIPAVLLCRGKKWKIDYHGNR 79 Query: 34 RPKCFDS-SWRK 2 R K DS WRK Sbjct: 80 RGKALDSKQWRK 91 >ref|XP_012831373.1| PREDICTED: B3 domain-containing protein Os04g0386900-like [Erythranthe guttatus] gi|604343350|gb|EYU42270.1| hypothetical protein MIMGU_mgv1a014840mg [Erythranthe guttata] Length = 176 Score = 71.2 bits (173), Expect = 2e-10 Identities = 36/98 (36%), Positives = 59/98 (60%), Gaps = 1/98 (1%) Frame = -2 Query: 295 TEKTDSSVTVIYSRTLTATVMTDLDKEEITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLD 116 TE + + ++R + + LD++EI L G+P++DLVLSKSHI + + FP ++ Sbjct: 21 TENAPENEEIRHTRFGSNSEPAKLDEDEIRYLSGKPYFDLVLSKSHISHTFGLLFPASMI 80 Query: 115 SLLPSTTVPSIIRCFGKTWEVKFCGER-RPKCFDSSWR 5 LP T+P++++ GK W + +CG RPK DS W+ Sbjct: 81 RELPRATIPAVLKNGGKIWNMSYCGGGVRPK-LDSGWK 117 >ref|XP_012831419.1| PREDICTED: B3 domain-containing protein Os04g0386900-like [Erythranthe guttatus] gi|604343348|gb|EYU42268.1| hypothetical protein MIMGU_mgv1a015135mg [Erythranthe guttata] Length = 167 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/73 (45%), Positives = 48/73 (65%) Frame = -2 Query: 223 DKEEITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFGKTWEVKFC 44 D++EI L G+P++DLVLSKSH+ P + P T+ S LP TTVP ++R G+TW + + Sbjct: 37 DEDEICYLSGKPYFDLVLSKSHLLP-NGLFVPVTISSTLPRTTVPVVLRHGGRTWNMSYV 95 Query: 43 GERRPKCFDSSWR 5 G + FDS W+ Sbjct: 96 GNMVRRRFDSQWK 108 >ref|XP_011086603.1| PREDICTED: B3 domain-containing protein REM16-like [Sesamum indicum] gi|747043969|ref|XP_011086612.1| PREDICTED: B3 domain-containing protein REM16-like [Sesamum indicum] Length = 260 Score = 68.6 bits (166), Expect = 2e-09 Identities = 38/121 (31%), Positives = 69/121 (57%), Gaps = 3/121 (2%) Frame = -2 Query: 355 VQILRCAIPPELQELRNKRKTEKTDSSVTV--IYSRTLTATVMTDLDKEEITPLIGE-PF 185 + ++R ++ P + LR T D+ T+ ++ T + ++++T L G+ PF Sbjct: 71 LSLIRSSLSPNIV-LRISSATSAKDAWDTIHTMFHNKTTENEVGSGSEDKVTYLSGDKPF 129 Query: 184 YDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFGKTWEVKFCGERRPKCFDSSWR 5 +D+ L +S + P+ M FP ++SLLPST + + +RC GK ++ F G+R+ K F S WR Sbjct: 130 FDMFLMRSTMKPLCQMIFPNRVESLLPSTNLQATVRCSGKIHKIHFYGQRKQKGFGSGWR 189 Query: 4 K 2 + Sbjct: 190 Q 190 >ref|XP_010910571.1| PREDICTED: B3 domain-containing protein Os04g0386900-like [Elaeis guineensis] Length = 192 Score = 68.6 bits (166), Expect = 2e-09 Identities = 27/73 (36%), Positives = 48/73 (65%) Frame = -2 Query: 223 DKEEITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFGKTWEVKFC 44 +K+EI PL G+P++ V++KS + + ++ P + LLPS VP+++ KTWE+++ Sbjct: 67 EKDEIVPLSGKPYFACVMTKSQVQAPFQLTIPKNIWMLLPSACVPAVLSYRNKTWEMRYY 126 Query: 43 GERRPKCFDSSWR 5 G+R + FDS W+ Sbjct: 127 GDRNLRRFDSGWK 139 >ref|XP_004307181.1| PREDICTED: B3 domain-containing protein Os04g0386900-like [Fragaria vesca subsp. vesca] Length = 131 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/83 (39%), Positives = 52/83 (62%), Gaps = 2/83 (2%) Frame = -2 Query: 247 TATVMTDLDKEEITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPS-TTVPSIIRCF 71 +AT M +L +E PL G P++D++L+KSH+ P+Y M P TLD LP+ T+VP ++ Sbjct: 8 SATPMIELHGDEFWPLSGRPYFDIILTKSHVKPIYQMEIPTTLDPNLPAGTSVPMVLSFG 67 Query: 70 GKTWEVKFCGERRPKCFD-SSWR 5 +WE+ + +R K D SW+ Sbjct: 68 ENSWEMTYNETKRLKLVDRHSWK 90 >ref|XP_004303740.1| PREDICTED: B3 domain-containing protein Os04g0386900-like [Fragaria vesca subsp. vesca] gi|764610099|ref|XP_011467480.1| PREDICTED: B3 domain-containing protein Os04g0386900-like [Fragaria vesca subsp. vesca] Length = 145 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/82 (36%), Positives = 50/82 (60%), Gaps = 1/82 (1%) Frame = -2 Query: 247 TATVMTDLDKEEITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFG 68 ++ + L EE PL G+PF+D++L+KSH+ P Y + P L S+LP ++P+++ G Sbjct: 8 SSDTIIQLHGEEFWPLSGKPFFDIILAKSHVKPSYMLGIPAKLHSILPPCSIPTVLNFAG 67 Query: 67 KTWEVKFCGERRPKCFD-SSWR 5 K+WE+ G+ R D SW+ Sbjct: 68 KSWEMTCGGKHRKHKLDKESWK 89 >emb|CDP19806.1| unnamed protein product [Coffea canephora] Length = 181 Score = 66.6 bits (161), Expect = 6e-09 Identities = 32/73 (43%), Positives = 48/73 (65%), Gaps = 1/73 (1%) Frame = -2 Query: 217 EEITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFGKTWEVKFCGE 38 +E++PL EPFY V+S SH++ + M FP L S LPS TVP+++ C GK+WE+ F G Sbjct: 53 DELSPLSEEPFYHHVVSFSHVNKLCHMVFPSRLRSDLPSKTVPAVVTCRGKSWEMTFLGG 112 Query: 37 RRPKCFD-SSWRK 2 + F+ SW++ Sbjct: 113 SQKLRFEVQSWKR 125 >ref|XP_004975400.1| PREDICTED: B3 domain-containing protein Os04g0386900-like [Setaria italica] Length = 179 Score = 66.6 bits (161), Expect = 6e-09 Identities = 25/69 (36%), Positives = 45/69 (65%) Frame = -2 Query: 211 ITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFGKTWEVKFCGERR 32 I PL+G+P++ ++ KSH+HP + + P +L LP TVP+ + G++WE++F G R+ Sbjct: 54 IVPLLGKPYFTCIMCKSHVHPPFQVVVPRSLAPFLPDATVPATVTWRGRSWEMRFTGGRQ 113 Query: 31 PKCFDSSWR 5 + ++ WR Sbjct: 114 IQRLEAGWR 122 >ref|XP_010943415.1| PREDICTED: B3 domain-containing protein Os04g0386900-like [Elaeis guineensis] Length = 185 Score = 65.5 bits (158), Expect = 1e-08 Identities = 26/73 (35%), Positives = 47/73 (64%) Frame = -2 Query: 223 DKEEITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFGKTWEVKFC 44 +K+EI PL G+P++ V++KS + + ++ P ++ LLP VP ++ KTWE+++ Sbjct: 60 EKDEIVPLSGKPYFACVMTKSQVQAPFQLTIPKSIWMLLPFACVPVVLSYRNKTWEMRYY 119 Query: 43 GERRPKCFDSSWR 5 G+R + FDS W+ Sbjct: 120 GDRNLRRFDSGWK 132 >emb|CDP07179.1| unnamed protein product [Coffea canephora] Length = 188 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 1/79 (1%) Frame = -2 Query: 235 MTDLDKEEITPLIGE-PFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFGKTW 59 M ++D E + G+ P++D++L+KSH+ P + + P T+ LPS VP ++ C GK W Sbjct: 54 MAEMDDIEYWTISGKKPYFDIILTKSHVGPRFQLFLPTTIVPALPSAMVPVVLTCCGKNW 113 Query: 58 EVKFCGERRPKCFDSSWRK 2 + G+R K F SW++ Sbjct: 114 NTVYYGDRTGKRFGPSWKE 132 >ref|XP_008802551.1| PREDICTED: B3 domain-containing protein Os04g0386900-like [Phoenix dactylifera] Length = 192 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/73 (35%), Positives = 46/73 (63%) Frame = -2 Query: 223 DKEEITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFGKTWEVKFC 44 +K+ PL G+P++ V++KS + + M+ P +LLPS +P+++ KTWE+++ Sbjct: 67 EKDGTVPLSGKPYFACVMTKSQVQAPFQMTIPKNFWTLLPSACIPAVLCYRNKTWEMRYY 126 Query: 43 GERRPKCFDSSWR 5 G+R K FDS W+ Sbjct: 127 GDRNLKRFDSGWK 139 >ref|XP_009343238.1| PREDICTED: B3 domain-containing protein Os04g0386900-like isoform X2 [Pyrus x bretschneideri] Length = 143 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/82 (31%), Positives = 49/82 (59%) Frame = -2 Query: 247 TATVMTDLDKEEITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFG 68 T+ M +L +E PL +PF+++V++K+++ P Y M P LPS ++P+++ G Sbjct: 6 TSNSMIELQGDEFWPLSEKPFFEVVITKANVKPSYQMVIPAKFQQTLPSCSIPTVLTLGG 65 Query: 67 KTWEVKFCGERRPKCFDSSWRK 2 K WE+ + + FD++WR+ Sbjct: 66 KNWEMTYTHGSGQRKFDTNWRE 87 >ref|XP_009343236.1| PREDICTED: B3 domain-containing protein Os04g0386900-like isoform X1 [Pyrus x bretschneideri] gi|694431663|ref|XP_009343237.1| PREDICTED: B3 domain-containing protein Os04g0386900-like isoform X1 [Pyrus x bretschneideri] Length = 144 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/82 (31%), Positives = 49/82 (59%) Frame = -2 Query: 247 TATVMTDLDKEEITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFG 68 T+ M +L +E PL +PF+++V++K+++ P Y M P LPS ++P+++ G Sbjct: 6 TSNSMIELQGDEFWPLSEKPFFEVVITKANVKPSYQMVIPAKFQQTLPSCSIPTVLTLGG 65 Query: 67 KTWEVKFCGERRPKCFDSSWRK 2 K WE+ + + FD++WR+ Sbjct: 66 KNWEMTYTHGSGQRKFDTNWRE 87 >ref|XP_004307182.1| PREDICTED: B3 domain-containing protein Os04g0386900-like [Fragaria vesca subsp. vesca] gi|764629615|ref|XP_011469454.1| PREDICTED: B3 domain-containing protein Os04g0386900-like [Fragaria vesca subsp. vesca] Length = 148 Score = 64.7 bits (156), Expect = 2e-08 Identities = 27/60 (45%), Positives = 42/60 (70%) Frame = -2 Query: 232 TDLDKEEITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFGKTWEV 53 T+L +E PL G+PF+D++L+KSH++P MS P + LLPS +VP ++ G+TWE+ Sbjct: 14 TELRGDEFWPLSGKPFFDIILTKSHVNPKCQMSIPSKIHPLLPSCSVPIVLTFAGRTWEM 73 >ref|XP_009341640.1| PREDICTED: B3 domain-containing protein Os04g0386900-like isoform X2 [Pyrus x bretschneideri] Length = 143 Score = 64.3 bits (155), Expect = 3e-08 Identities = 26/82 (31%), Positives = 49/82 (59%) Frame = -2 Query: 247 TATVMTDLDKEEITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFG 68 T+ M +L +E PL +PF+++V++K+++ P Y M P LPS ++P+++ G Sbjct: 6 TSNSMIELQGDEFWPLSEKPFFEVVITKANVKPSYQMVIPAKFQQTLPSCSIPTVLTFGG 65 Query: 67 KTWEVKFCGERRPKCFDSSWRK 2 K WE+ + + FD++WR+ Sbjct: 66 KNWEMTYTHGSGQRKFDTNWRE 87 >ref|XP_009341637.1| PREDICTED: B3 domain-containing protein Os04g0386900-like isoform X1 [Pyrus x bretschneideri] gi|694428098|ref|XP_009341638.1| PREDICTED: B3 domain-containing protein Os04g0386900-like isoform X1 [Pyrus x bretschneideri] gi|694428100|ref|XP_009341639.1| PREDICTED: B3 domain-containing protein Os04g0386900-like isoform X1 [Pyrus x bretschneideri] Length = 145 Score = 64.3 bits (155), Expect = 3e-08 Identities = 26/82 (31%), Positives = 49/82 (59%) Frame = -2 Query: 247 TATVMTDLDKEEITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFG 68 T+ M +L +E PL +PF+++V++K+++ P Y M P LPS ++P+++ G Sbjct: 6 TSNSMIELQGDEFWPLSEKPFFEVVITKANVKPSYQMVIPAKFQQTLPSCSIPTVLTFGG 65 Query: 67 KTWEVKFCGERRPKCFDSSWRK 2 K WE+ + + FD++WR+ Sbjct: 66 KNWEMTYTHGSGQRKFDTNWRE 87 >ref|XP_008776698.1| PREDICTED: B3 domain-containing protein Os04g0386900-like [Phoenix dactylifera] Length = 162 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/94 (31%), Positives = 50/94 (53%) Frame = -2 Query: 283 DSSVTVIYSRTLTATVMTDLDKEEITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLP 104 +SSV + + +T ++E PL G P++ ++SKS + ++ P SLLP Sbjct: 15 ESSVRSHAPQQIQTEPITPAVQDEAVPLSGSPYFTCIVSKSQTQSPFQLAVPRRFCSLLP 74 Query: 103 STTVPSIIRCFGKTWEVKFCGERRPKCFDSSWRK 2 S +V + C +TWE+++CG K FD W+K Sbjct: 75 SESVSVFLSCERRTWEMRYCGSSSLKRFDRGWKK 108 >ref|NP_001142732.1| uncharacterized protein LOC100275071 [Zea mays] gi|195608904|gb|ACG26282.1| hypothetical protein [Zea mays] gi|413918129|gb|AFW58061.1| hypothetical protein ZEAMMB73_242659 [Zea mays] Length = 159 Score = 64.3 bits (155), Expect = 3e-08 Identities = 24/69 (34%), Positives = 45/69 (65%) Frame = -2 Query: 211 ITPLIGEPFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFGKTWEVKFCGERR 32 + PL+G+P++ +L KSH++ + + P +L LP TTVP+ + G++WE++F G R+ Sbjct: 34 VVPLLGKPYFTCILCKSHVNQPFQVVVPKSLAPFLPGTTVPATVTWHGRSWEMRFTGGRQ 93 Query: 31 PKCFDSSWR 5 + ++ WR Sbjct: 94 IQRLEAGWR 102 >ref|XP_004964321.1| PREDICTED: B3 domain-containing protein Os06g0112300-like [Setaria italica] Length = 209 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%) Frame = -2 Query: 223 DKEEITPLIGE-PFYDLVLSKSHIHPVYDMSFPPTLDSLLPSTTVPSIIRCFGKTWEVKF 47 D E+TPL GE PF+ VLSKS + + + P L LP VP+ + C G++W + Sbjct: 77 DDWEVTPLSGEHPFFTTVLSKSQVQKQFQLVIPARLHRHLPEARVPATLLCRGRSWAASY 136 Query: 46 CGERRPKCFDSSWR 5 CG+ + K D++WR Sbjct: 137 CGDLKCKKIDAAWR 150