BLASTX nr result
ID: Forsythia21_contig00042813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00042813 (772 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012831870.1| PREDICTED: threonine dehydratase biosyntheti... 72 4e-10 gb|EYU41567.1| hypothetical protein MIMGU_mgv1a003249mg [Erythra... 72 4e-10 ref|XP_012836071.1| PREDICTED: threonine dehydratase biosyntheti... 71 8e-10 ref|XP_012836070.1| PREDICTED: threonine dehydratase biosyntheti... 71 8e-10 ref|XP_011101468.1| PREDICTED: threonine dehydratase biosyntheti... 70 1e-09 ref|XP_011094452.1| PREDICTED: LOW QUALITY PROTEIN: threonine de... 67 1e-08 ref|XP_009590879.1| PREDICTED: threonine dehydratase biosyntheti... 67 1e-08 ref|XP_010069098.1| PREDICTED: threonine dehydratase biosyntheti... 65 4e-08 gb|KCW89298.1| hypothetical protein EUGRSUZ_A015882 [Eucalyptus ... 65 4e-08 ref|XP_010242986.1| PREDICTED: threonine dehydratase biosyntheti... 65 6e-08 ref|XP_009774928.1| PREDICTED: threonine dehydratase biosyntheti... 64 8e-08 ref|XP_010923370.1| PREDICTED: threonine dehydratase biosyntheti... 63 2e-07 ref|XP_009793990.1| PREDICTED: threonine dehydratase biosyntheti... 62 3e-07 ref|XP_008794048.1| PREDICTED: threonine dehydratase biosyntheti... 62 3e-07 ref|XP_007226799.1| hypothetical protein PRUPE_ppa017851mg [Prun... 62 3e-07 ref|XP_009593672.1| PREDICTED: threonine dehydratase biosyntheti... 61 7e-07 ref|XP_007203765.1| hypothetical protein PRUPE_ppa003062mg [Prun... 61 9e-07 ref|XP_011018852.1| PREDICTED: threonine dehydratase biosyntheti... 60 1e-06 ref|XP_008796630.1| PREDICTED: threonine dehydratase biosyntheti... 60 1e-06 ref|XP_006381341.1| hypothetical protein POPTR_0006s11980g [Popu... 60 1e-06 >ref|XP_012831870.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Erythranthe guttatus] Length = 612 Score = 72.0 bits (175), Expect = 4e-10 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLMQ 635 GETGANVLVGIQV+ SEMD FR A SLGYEYEVET NEAF LLM+ Sbjct: 567 GETGANVLVGIQVSDSEMDEFRDRADSLGYEYEVETGNEAFQLLMR 612 >gb|EYU41567.1| hypothetical protein MIMGU_mgv1a003249mg [Erythranthe guttata] Length = 597 Score = 72.0 bits (175), Expect = 4e-10 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLMQ 635 GETGANVLVGIQV+ SEMD FR A SLGYEYEVET NEAF LLM+ Sbjct: 552 GETGANVLVGIQVSDSEMDEFRDRADSLGYEYEVETGNEAFQLLMR 597 >ref|XP_012836071.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic isoform X2 [Erythranthe guttatus] Length = 496 Score = 70.9 bits (172), Expect = 8e-10 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLMQ 635 GETGANVLVGIQVA +EM FR A SLGYEYE+ET+NEAF LLM+ Sbjct: 451 GETGANVLVGIQVAQNEMGEFRGRANSLGYEYELETSNEAFQLLMR 496 >ref|XP_012836070.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic isoform X1 [Erythranthe guttatus] gi|604334507|gb|EYU38591.1| hypothetical protein MIMGU_mgv1a003122mg [Erythranthe guttata] Length = 606 Score = 70.9 bits (172), Expect = 8e-10 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLMQ 635 GETGANVLVGIQVA +EM FR A SLGYEYE+ET+NEAF LLM+ Sbjct: 561 GETGANVLVGIQVAQNEMGEFRGRANSLGYEYELETSNEAFQLLMR 606 >ref|XP_011101468.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Sesamum indicum] Length = 610 Score = 70.5 bits (171), Expect = 1e-09 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLMQ 635 GETGANVLVGIQVA EMD FR A SLGYEYE+E++NEAF LLM+ Sbjct: 565 GETGANVLVGIQVAQHEMDEFRDRANSLGYEYELESSNEAFQLLMR 610 >ref|XP_011094452.1| PREDICTED: LOW QUALITY PROTEIN: threonine dehydratase biosynthetic, chloroplastic [Sesamum indicum] Length = 604 Score = 67.0 bits (162), Expect = 1e-08 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLMQ 635 GE GANVLVGIQVA +EMD FR A S+GY YEVET NEAF LLM+ Sbjct: 559 GEMGANVLVGIQVADTEMDEFRDRANSIGYGYEVETRNEAFQLLMR 604 >ref|XP_009590879.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Nicotiana tomentosiformis] Length = 601 Score = 67.0 bits (162), Expect = 1e-08 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLM 638 GETGANVL+GIQV SE+D FRA A +LGYEY +ET NEAF LLM Sbjct: 556 GETGANVLIGIQVPQSEVDEFRARADTLGYEYVLETLNEAFQLLM 600 >ref|XP_010069098.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic, partial [Eucalyptus grandis] Length = 545 Score = 65.5 bits (158), Expect = 4e-08 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLM 638 GETGANVLVGIQV SEMD F+ CA LGY+Y + T +EAF LLM Sbjct: 498 GETGANVLVGIQVTQSEMDEFKECADGLGYDYAMVTNDEAFRLLM 542 >gb|KCW89298.1| hypothetical protein EUGRSUZ_A015882 [Eucalyptus grandis] Length = 502 Score = 65.5 bits (158), Expect = 4e-08 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLM 638 GETGANVLVGIQV SEMD F+ CA LGY+Y + T +EAF LLM Sbjct: 455 GETGANVLVGIQVTQSEMDEFKECADGLGYDYAMVTNDEAFRLLM 499 >ref|XP_010242986.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic [Nelumbo nucifera] Length = 610 Score = 64.7 bits (156), Expect = 6e-08 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLMQ 635 GETGANVLVGIQVA +EM+ F+ A +LGY+Y +ET+NEAF LL Q Sbjct: 565 GETGANVLVGIQVASNEMEEFKDRANTLGYDYMIETSNEAFRLLTQ 610 >ref|XP_009774928.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic [Nicotiana sylvestris] Length = 602 Score = 64.3 bits (155), Expect = 8e-08 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLMQ 635 G+TGANVLVGIQV +E+D F+ A SLGYEY VE+ NEAF L+MQ Sbjct: 557 GDTGANVLVGIQVPQAEVDEFQGRADSLGYEYAVESLNEAFQLIMQ 602 >ref|XP_010923370.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Elaeis guineensis] Length = 300 Score = 62.8 bits (151), Expect = 2e-07 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLMQ 635 GETGANVLVGIQV +M+ FR A +LGYEY E TNEA+ LLMQ Sbjct: 255 GETGANVLVGIQVPKEDMEEFRNKANNLGYEYAYEVTNEAYKLLMQ 300 >ref|XP_009793990.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Nicotiana sylvestris] Length = 601 Score = 62.4 bits (150), Expect = 3e-07 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLM 638 GETGANVLVGIQV E+ F+A A +LGYEY VET NEAF +LM Sbjct: 556 GETGANVLVGIQVPQGEVGEFKARADTLGYEYVVETLNEAFQILM 600 >ref|XP_008794048.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic [Phoenix dactylifera] Length = 618 Score = 62.4 bits (150), Expect = 3e-07 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLMQ 635 GETGANVLVGIQVA +M+ F A LGYEY E TNEA+ LLMQ Sbjct: 573 GETGANVLVGIQVAKEDMEEFANQANKLGYEYTYEVTNEAYQLLMQ 618 >ref|XP_007226799.1| hypothetical protein PRUPE_ppa017851mg [Prunus persica] gi|462423735|gb|EMJ27998.1| hypothetical protein PRUPE_ppa017851mg [Prunus persica] Length = 88 Score = 62.4 bits (150), Expect = 3e-07 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLM 638 GETGANVLVGIQVA E+D F+AC +SLGY+Y V T + F LLM Sbjct: 43 GETGANVLVGIQVARGEIDEFQACGSSLGYDYVVVTDDNEFSLLM 87 >ref|XP_009593672.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic [Nicotiana tomentosiformis] Length = 605 Score = 61.2 bits (147), Expect = 7e-07 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLM 638 G+TGANVLVGIQV +E+D F+ A SLGYEY +E+ NEAF L+M Sbjct: 560 GDTGANVLVGIQVPQAEVDEFQGRADSLGYEYAMESLNEAFQLIM 604 >ref|XP_007203765.1| hypothetical protein PRUPE_ppa003062mg [Prunus persica] gi|462399296|gb|EMJ04964.1| hypothetical protein PRUPE_ppa003062mg [Prunus persica] Length = 607 Score = 60.8 bits (146), Expect = 9e-07 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLM 638 GETGANVLVGIQVA ++D F+A A SLGY+Y V T N+ F+LLM Sbjct: 562 GETGANVLVGIQVARGDIDEFQARAGSLGYDYAVVTDNDEFNLLM 606 >ref|XP_011018852.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic [Populus euphratica] Length = 614 Score = 60.5 bits (145), Expect = 1e-06 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLM 638 GETGANVLVGIQV SEMD F + A SLGY+Y + T + FHLLM Sbjct: 569 GETGANVLVGIQVPQSEMDEFCSRANSLGYDYVIVTDDNEFHLLM 613 >ref|XP_008796630.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Phoenix dactylifera] Length = 615 Score = 60.5 bits (145), Expect = 1e-06 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLMQ 635 GETGANVLVGIQV +M+ FR A +LGYEY TNEA+ LLMQ Sbjct: 570 GETGANVLVGIQVPKEDMEEFRNKANTLGYEYAYGVTNEAYQLLMQ 615 >ref|XP_006381341.1| hypothetical protein POPTR_0006s11980g [Populus trichocarpa] gi|550336043|gb|ERP59138.1| hypothetical protein POPTR_0006s11980g [Populus trichocarpa] Length = 614 Score = 60.5 bits (145), Expect = 1e-06 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -1 Query: 772 GETGANVLVGIQVAHSEMDGFRACATSLGYEYEVETTNEAFHLLM 638 GETGANVLVGIQV SEMD F + A SLGY+Y V T + FHLLM Sbjct: 569 GETGANVLVGIQVPQSEMDEFCSRANSLGYDYVVVTDDNDFHLLM 613