BLASTX nr result
ID: Forsythia21_contig00041302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00041302 (346 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBG37777.1| putative small heat shock protein [Olea europaea] 90 5e-16 gb|ABF61869.1| chaperone [Agave tequilana] 66 1e-08 ref|XP_004505963.1| PREDICTED: 17.3 kDa class I heat shock prote... 65 1e-08 gb|ABF61868.1| chaperone [Agave tequilana] 65 1e-08 gb|ABF61865.1| chaperone [Agave tequilana] 65 1e-08 ref|XP_004505085.1| PREDICTED: 18.5 kDa class I heat shock prote... 65 2e-08 gb|ABF61867.1| chaperone [Agave tequilana] gi|99033705|gb|ABF618... 65 2e-08 ref|XP_012088215.1| PREDICTED: 17.8 kDa class I heat shock prote... 65 2e-08 ref|XP_002315187.1| 18.2 kDa class I heat shock family protein [... 65 2e-08 sp|P27880.1|HSP12_MEDSA RecName: Full=18.2 kDa class I heat shoc... 65 2e-08 gb|ABF61863.1| chaperone [Agave tequilana] 65 2e-08 ref|XP_011084988.1| PREDICTED: 17.3 kDa class I heat shock prote... 64 3e-08 gb|ABF61872.1| chaperone [Agave tequilana] 64 3e-08 ref|XP_011036031.1| PREDICTED: 18.1 kDa class I heat shock prote... 64 4e-08 ref|XP_004516546.1| PREDICTED: 18.2 kDa class I heat shock prote... 64 4e-08 ref|XP_004505087.1| PREDICTED: 18.5 kDa class I heat shock prote... 64 4e-08 ref|XP_004505083.1| PREDICTED: 18.5 kDa class I heat shock prote... 64 4e-08 ref|XP_011099770.1| PREDICTED: 17.5 kDa class I heat shock prote... 64 5e-08 gb|ABF61875.1| chaperone [Agave tequilana] 64 5e-08 gb|KHN46264.1| 17.3 kDa class I heat shock protein [Glycine soja] 63 7e-08 >emb|CBG37777.1| putative small heat shock protein [Olea europaea] Length = 160 Score = 90.1 bits (222), Expect = 5e-16 Identities = 38/46 (82%), Positives = 46/46 (100%) Frame = +2 Query: 209 MSLIPSVFGQRSNVFDPFSLDLWDPFKDWPFNSALSAPVRSDLSNE 346 M+LIPSVFG+RSNVFDPFSLD+WDPF+DWPF+SA+SAP+RSD+SNE Sbjct: 1 MALIPSVFGRRSNVFDPFSLDVWDPFQDWPFSSAVSAPIRSDISNE 46 >gb|ABF61869.1| chaperone [Agave tequilana] Length = 161 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/47 (59%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 209 MSLIPSVFGQRSNVFDPFSLDLWDPFKDWPFNSALSAPVR-SDLSNE 346 M+LIP +FGQR+NVFDPFSLD+WDPF+ WPF+ +++ R SD +E Sbjct: 1 MALIPQIFGQRTNVFDPFSLDIWDPFQGWPFDRSITGQSRPSDALSE 47 >ref|XP_004505963.1| PREDICTED: 17.3 kDa class I heat shock protein-like [Cicer arietinum] Length = 213 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = +2 Query: 194 KQYQKMSLIPSVFG-QRSNVFDPFSLDLWDPFKDWPFNSA 310 K+ KMSLIPS FG +RSNV+DPFSLDLWDPFKD+PF+S+ Sbjct: 54 KEKNKMSLIPSFFGGRRSNVYDPFSLDLWDPFKDFPFSSS 93 >gb|ABF61868.1| chaperone [Agave tequilana] Length = 161 Score = 65.5 bits (158), Expect = 1e-08 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = +2 Query: 209 MSLIPSVFGQRSNVFDPFSLDLWDPFKDWPFNSALSAPVR 328 M+LIP +FGQR+NVFDPFSLD+WDPF+ WPF+ +++ R Sbjct: 1 MALIPQIFGQRTNVFDPFSLDIWDPFQGWPFDRSITGQSR 40 >gb|ABF61865.1| chaperone [Agave tequilana] Length = 161 Score = 65.5 bits (158), Expect = 1e-08 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = +2 Query: 209 MSLIPSVFGQRSNVFDPFSLDLWDPFKDWPFNSALSAPVR 328 M+LIP +FGQR+NVFDPFSLD+WDPF+ WPF+ +++ R Sbjct: 1 MALIPQIFGQRTNVFDPFSLDIWDPFQGWPFDRSITGQSR 40 >ref|XP_004505085.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Cicer arietinum] Length = 160 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/38 (78%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = +2 Query: 209 MSLIPSVFG-QRSNVFDPFSLDLWDPFKDWPFNSALSA 319 MSLIPS FG +RSNV+DPFSLDLWDPFKD+PF+S++SA Sbjct: 1 MSLIPSFFGGRRSNVYDPFSLDLWDPFKDFPFSSSVSA 38 >gb|ABF61867.1| chaperone [Agave tequilana] gi|99033705|gb|ABF61874.1| chaperone [Agave tequilana] gi|99033709|gb|ABF61876.1| chaperone [Agave tequilana] Length = 159 Score = 65.1 bits (157), Expect = 2e-08 Identities = 24/37 (64%), Positives = 34/37 (91%) Frame = +2 Query: 209 MSLIPSVFGQRSNVFDPFSLDLWDPFKDWPFNSALSA 319 M+LIP +FGQR+N+FDPFSLD+WDPF+ WPF+ +L++ Sbjct: 1 MALIPQIFGQRTNIFDPFSLDVWDPFQGWPFDRSLTS 37 >ref|XP_012088215.1| PREDICTED: 17.8 kDa class I heat shock protein-like [Jatropha curcas] gi|643739039|gb|KDP44853.1| hypothetical protein JCGZ_01353 [Jatropha curcas] Length = 162 Score = 64.7 bits (156), Expect = 2e-08 Identities = 34/49 (69%), Positives = 41/49 (83%), Gaps = 3/49 (6%) Frame = +2 Query: 209 MSLIPSVF--GQRSNVFDPFSLDLWDPFKDWPFNS-ALSAPVRSDLSNE 346 MSLIPS G+R+N+FDPFSLD+WDPF+D+PF S ALSAP RS+L NE Sbjct: 1 MSLIPSTLFGGRRTNIFDPFSLDIWDPFQDFPFTSTALSAP-RSELLNE 48 >ref|XP_002315187.1| 18.2 kDa class I heat shock family protein [Populus trichocarpa] gi|222864227|gb|EEF01358.1| 18.2 kDa class I heat shock family protein [Populus trichocarpa] Length = 162 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/49 (67%), Positives = 41/49 (83%), Gaps = 3/49 (6%) Frame = +2 Query: 209 MSLIPSVF--GQRSNVFDPFSLDLWDPFKDWPFNS-ALSAPVRSDLSNE 346 MSLIPS G+RSN+FDPFSLD+WDPF+D+PF S A+SAP RS+ +NE Sbjct: 1 MSLIPSTLFGGRRSNIFDPFSLDIWDPFQDFPFTSTAISAP-RSEFANE 48 >sp|P27880.1|HSP12_MEDSA RecName: Full=18.2 kDa class I heat shock protein gi|19618|emb|CAA41547.1| heat shock protein [Medicago sativa] Length = 158 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/39 (84%), Positives = 36/39 (92%), Gaps = 2/39 (5%) Frame = +2 Query: 209 MSLIPSVFG-QRSNVFDPFSLDLWDPFKDWPF-NSALSA 319 MSLIPS FG +RSNVFDPFSLD+WDPFKD+PF NSALSA Sbjct: 1 MSLIPSFFGGRRSNVFDPFSLDVWDPFKDFPFNNSALSA 39 >gb|ABF61863.1| chaperone [Agave tequilana] Length = 162 Score = 64.7 bits (156), Expect = 2e-08 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +2 Query: 209 MSLIPSVFGQRSNVFDPFSLDLWDPFKDWPFNSALS 316 M+LIP +FGQRSN+FDPFSLD+WDPF+ WPF+ +++ Sbjct: 1 MALIPQIFGQRSNIFDPFSLDVWDPFQGWPFDRSVT 36 >ref|XP_011084988.1| PREDICTED: 17.3 kDa class I heat shock protein-like [Sesamum indicum] Length = 150 Score = 64.3 bits (155), Expect = 3e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +2 Query: 209 MSLIPSVFGQRSNVFDPFSLDLWDPFKDWPFNSA 310 MSLIPSVFG+RS+VFDP S+DLWDPF+DWP +S+ Sbjct: 1 MSLIPSVFGRRSSVFDPLSMDLWDPFRDWPVSSS 34 >gb|ABF61872.1| chaperone [Agave tequilana] Length = 161 Score = 64.3 bits (155), Expect = 3e-08 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +2 Query: 209 MSLIPSVFGQRSNVFDPFSLDLWDPFKDWPFNSALSAPVR 328 M+LIP +FGQR+NVFDPFSLD WDPF+ WPF+ +++ R Sbjct: 1 MALIPQIFGQRTNVFDPFSLDTWDPFQGWPFDRSITGQSR 40 >ref|XP_011036031.1| PREDICTED: 18.1 kDa class I heat shock protein-like [Populus euphratica] Length = 162 Score = 63.9 bits (154), Expect = 4e-08 Identities = 33/49 (67%), Positives = 41/49 (83%), Gaps = 3/49 (6%) Frame = +2 Query: 209 MSLIPSVF--GQRSNVFDPFSLDLWDPFKDWPFNS-ALSAPVRSDLSNE 346 MSLIPS G+RSN+FDPFSLD+WDPF+D+PF S A+SAP RS+ +NE Sbjct: 1 MSLIPSTLFGGRRSNIFDPFSLDIWDPFQDFPFTSTAISAP-RSESANE 48 >ref|XP_004516546.1| PREDICTED: 18.2 kDa class I heat shock protein-like [Cicer arietinum] Length = 160 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/38 (76%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = +2 Query: 209 MSLIPSVFG-QRSNVFDPFSLDLWDPFKDWPFNSALSA 319 MSLIPS FG +RSNV+DPFSLD+WDPFKD+PF+S++SA Sbjct: 1 MSLIPSFFGGRRSNVYDPFSLDVWDPFKDFPFSSSVSA 38 >ref|XP_004505087.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Cicer arietinum] Length = 160 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/38 (76%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = +2 Query: 209 MSLIPSVFG-QRSNVFDPFSLDLWDPFKDWPFNSALSA 319 MSLIPS FG +RSNV+DPFSLDLWDPFKD+PF+S++S+ Sbjct: 1 MSLIPSFFGGRRSNVYDPFSLDLWDPFKDFPFSSSVSS 38 >ref|XP_004505083.1| PREDICTED: 18.5 kDa class I heat shock protein [Cicer arietinum] Length = 160 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/38 (76%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = +2 Query: 209 MSLIPSVFG-QRSNVFDPFSLDLWDPFKDWPFNSALSA 319 MSLIPS FG +RSNV+DPFSLDLWDPFKD+PF+S++S+ Sbjct: 1 MSLIPSFFGGRRSNVYDPFSLDLWDPFKDFPFSSSVSS 38 >ref|XP_011099770.1| PREDICTED: 17.5 kDa class I heat shock protein-like [Sesamum indicum] Length = 150 Score = 63.5 bits (153), Expect = 5e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +2 Query: 209 MSLIPSVFGQRSNVFDPFSLDLWDPFKDWPFNSA 310 MSLIPSVFG+R +VFDP SLDLWDPF+DWP +S+ Sbjct: 1 MSLIPSVFGRRGSVFDPLSLDLWDPFRDWPVSSS 34 >gb|ABF61875.1| chaperone [Agave tequilana] Length = 161 Score = 63.5 bits (153), Expect = 5e-08 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +2 Query: 209 MSLIPSVFGQRSNVFDPFSLDLWDPFKDWPFNSALSAPVR 328 M+LIP +FGQR+NVFDPFSLD WDPF+ WPF+ +++ R Sbjct: 1 MALIPQIFGQRTNVFDPFSLDPWDPFQGWPFDRSITGQSR 40 >gb|KHN46264.1| 17.3 kDa class I heat shock protein [Glycine soja] Length = 153 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/38 (78%), Positives = 35/38 (92%), Gaps = 1/38 (2%) Frame = +2 Query: 209 MSLIPSVFG-QRSNVFDPFSLDLWDPFKDWPFNSALSA 319 MSLIPS FG +RS+VFDPFSLD+WDPFKD+PF S+LSA Sbjct: 1 MSLIPSFFGGRRSSVFDPFSLDVWDPFKDFPFPSSLSA 38