BLASTX nr result
ID: Forsythia21_contig00039909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00039909 (356 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13260.1| unnamed protein product [Coffea canephora] 58 3e-06 ref|XP_011086692.1| PREDICTED: uncharacterized protein LOC105168... 57 6e-06 gb|KEH20737.1| hypothetical protein MTR_8g089640 [Medicago trunc... 57 6e-06 gb|KMT07605.1| hypothetical protein BVRB_6g147340 [Beta vulgaris... 56 8e-06 gb|KJB15661.1| hypothetical protein B456_002G189100 [Gossypium r... 56 8e-06 >emb|CDP13260.1| unnamed protein product [Coffea canephora] Length = 64 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 248 FFGMSM*AFIFWQTMEKVHFWIALRQDEKQE 156 FFGM+ AFIFWQTM+KVH WIAL QDEKQE Sbjct: 7 FFGMAFGAFIFWQTMDKVHVWIALHQDEKQE 37 >ref|XP_011086692.1| PREDICTED: uncharacterized protein LOC105168337 [Sesamum indicum] Length = 63 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 248 FFGMSM*AFIFWQTMEKVHFWIALRQDEKQE 156 FFGMS AF+FWQTM+KVH WIAL QDEK+E Sbjct: 7 FFGMSFGAFLFWQTMDKVHVWIALHQDEKKE 37 >gb|KEH20737.1| hypothetical protein MTR_8g089640 [Medicago truncatula] Length = 64 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 248 FFGMSM*AFIFWQTMEKVHFWIALRQDEKQE 156 +FGMS+ AF+FWQ+M+KVH WIAL QDEKQE Sbjct: 7 YFGMSLAAFVFWQSMDKVHVWIALHQDEKQE 37 >gb|KMT07605.1| hypothetical protein BVRB_6g147340 [Beta vulgaris subsp. vulgaris] Length = 63 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 248 FFGMSM*AFIFWQTMEKVHFWIALRQDEKQE 156 FFGMS+ AF+FWQ+M+KVH WIAL QDEK+E Sbjct: 7 FFGMSLGAFVFWQSMDKVHVWIALHQDEKRE 37 >gb|KJB15661.1| hypothetical protein B456_002G189100 [Gossypium raimondii] Length = 63 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 248 FFGMSM*AFIFWQTMEKVHFWIALRQDEKQE 156 +FGMS+ AF+FWQ+MEKVH WIAL QDEK+E Sbjct: 7 YFGMSLGAFVFWQSMEKVHVWIALHQDEKKE 37