BLASTX nr result
ID: Forsythia21_contig00039589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00039589 (430 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007158215.1| hypothetical protein PHAVU_002G133900g, part... 58 3e-06 ref|XP_006432661.1| hypothetical protein CICLE_v10003017mg [Citr... 57 4e-06 ref|XP_006368337.1| hypothetical protein POPTR_0001s01750g [Popu... 57 5e-06 ref|XP_002518997.1| conserved hypothetical protein [Ricinus comm... 57 6e-06 >ref|XP_007158215.1| hypothetical protein PHAVU_002G133900g, partial [Phaseolus vulgaris] gi|561031630|gb|ESW30209.1| hypothetical protein PHAVU_002G133900g, partial [Phaseolus vulgaris] Length = 84 Score = 57.8 bits (138), Expect = 3e-06 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -1 Query: 340 WQRKPWMNHGSSRGPRGSIVNPTIEHPFQVPKLPV 236 W RK WMNHGS RGP+ ++NPTI+HPFQ +LP+ Sbjct: 50 WHRKTWMNHGSHRGPKKHLLNPTIQHPFQPRELPL 84 >ref|XP_006432661.1| hypothetical protein CICLE_v10003017mg [Citrus clementina] gi|557534783|gb|ESR45901.1| hypothetical protein CICLE_v10003017mg [Citrus clementina] Length = 80 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 2/37 (5%) Frame = -1 Query: 340 WQRKPWMNHGSSRGPRGSIVNPTI--EHPFQVPKLPV 236 WQ KP MNHGS RGPR +V+PT EHPF+VPKLPV Sbjct: 44 WQHKPQMNHGSFRGPRKHLVDPTAAEEHPFEVPKLPV 80 >ref|XP_006368337.1| hypothetical protein POPTR_0001s01750g [Populus trichocarpa] gi|550346243|gb|ERP64906.1| hypothetical protein POPTR_0001s01750g [Populus trichocarpa] Length = 127 Score = 57.0 bits (136), Expect = 5e-06 Identities = 32/77 (41%), Positives = 47/77 (61%), Gaps = 12/77 (15%) Frame = -1 Query: 430 VKFRAIFNFMCLLLIILSSSW----VDGKEDGWR--------WQRKPWMNHGSSRGPRGS 287 V +A+ ++ L L++ +SS V G+ G W+R +NHGS+RGPR Sbjct: 54 VLVKAMLKYLVLFLVLFTSSVSVHSVAGEAVGKNNVAKSYRSWRR---INHGSARGPRKH 110 Query: 286 IVNPTIEHPFQVPKLPV 236 +VNPT+EHPF+VP+LPV Sbjct: 111 LVNPTVEHPFEVPELPV 127 >ref|XP_002518997.1| conserved hypothetical protein [Ricinus communis] gi|223541984|gb|EEF43530.1| conserved hypothetical protein [Ricinus communis] Length = 74 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 340 WQRKPWMNHGSSRGPRGSIVNPTIEHPFQVPKLPV 236 WQR +NHGS RGPR IVNPT++HPFQVPK+PV Sbjct: 43 WQR---VNHGSLRGPRKHIVNPTVKHPFQVPKMPV 74